TkA01G506370 | RubberDandelionOmics

Gene overview

TkA01G506370

Reference: TK1151 Chr: Chr01 Coordinates: 126788537-126798771 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1137 bp · TkA01G506370|TK1151|cDNA

ATGGATTCTTTAATTAGGGAAATAGAGGACCTTAAATATGATGGGTATGAACTTAGAAAGGCTCAAAAACCCCTTAAAGAACAATTAGAGGCCAAAACGAAATACTTCAAACAAGTCTATGAGGAACTTTATATCAAATCTTGTTTGGGTGAATTTTACCGATCAAACTTGATCGGATTGACAGCTGAACTTGCTGCATCAAATGCTAGATTTAAGAATGCTGAGTTTAATTTTAAAAAATTTGATGTGTCAAGTGAAAA...

CDS

Download CDS FASTA

1137 bp · TkA01G506370|TK1151|CDS

ATGGATTCTTTAATTAGGGAAATAGAGGACCTTAAATATGATGGGTATGAACTTAGAAAGGCTCAAAAACCCCTTAAAGAACAATTAGAGGCCAAAACGAAATACTTCAAACAAGTCTATGAGGAACTTTATATCAAATCTTGTTTGGGTGAATTTTACCGATCAAACTTGATCGGATTGACAGCTGAACTTGCTGCATCAAATGCTAGATTTAAGAATGCTGAGTTTAATTTTAAAAAATTTGATGTGTCAAGTGAAAA...

Protein

Download Protein FASTA

378 aa · TkA01G506370|TK1151|PROTEIN

MDSLIREIEDLKYDGYELRKAQKPLKEQLEAKTKYFKQVYEELYIKSCLGEFYRSNLIGLTAELAASNARFKNAEFNFKKFDVSSEKVEVMIENHMKWQDKQGEGLGYSAVPPPYNYTPPLEPVVLRRPPPVNQSTVPVSTTIEKPKQEETKKANQSNASTSCADEVLVEDWDEEDENGSSSSNTNILSPADSNNYFYVKKQTCYNCGIAGHIARNCPHRPYVPYYAQGWENVPRGSSSKRKPSRSQSRYGDWTVHKDKK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G506370`
TK1151 ID	TkA01G506370
OH-1004 ID	LXL04_015014
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.400
Protein coverage (%)	TK1151 96.561 / OH-1004 23.042 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G506370`
Location	Chr01:126788537-126798771 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015014` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003690 double-stranded DNA binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference	ath:AT4G36020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.687

Rank 1 · TkA01G506370 · TK1151

Nucleus0.334

Rank 2 · TkA01G506370 · TK1151

Cell membrane0.082

Rank 3 · TkA01G506370 · TK1151

Mitochondrion0.049

Rank 4 · TkA01G506370 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA01G506370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16681Ig_5140-207 aa

PF30379SLU7_N200-221 aa

PF00098zf-CCHC203-219 aa

PF14392zf-CCHC_4203-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G506370	`PF16681`	Ig_5	140	207	0.058	14.5
TkA01G506370	`PF30379`	SLU7_N	200	221	6.7e-06	26.2
TkA01G506370	`PF00098`	zf-CCHC	203	219	4.9e-07	30.3
TkA01G506370	`PF14392`	zf-CCHC_4	203	218	0.22	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card