TkA01G503660 | RubberDandelionOmics

Gene overview

TkA01G503660

Reference: TK1151 Chr: Chr01 Coordinates: 126119635-126121124 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1412 bp · TkA01G503660|TK1151|cDNA

TGACATGCTTGTTTCATTGTTTCCATGAAAAAACAAAAGGCAAAACGAAAGATTGTGTGTACCAAATGTTTACATGTTTTTAAAACCAAAGTTAGTTTTTTGTACGTTACGAAAATGATAAAATTTCCAGATATATAAATAAATTTTAAAGGAAATTTTTTAAATATAATATTCAAGTTTGTATCAAAAATTCAATCGCTCCAGCTTTTAGCCACACACAACTTTTCCTTTCTTCCTTCTTCATCTTCATCGGTGTTCTT...

CDS

Download CDS FASTA

570 bp · TkA01G503660|TK1151|CDS

ATGCAGGGACGCGAAAAGCGGCGTTGGCCGTCGTGGAAGAACCTCAAACGGCGGGTTGGAACCGGATGGAAGCGAATCAATATCATGGGTTGTTGCGGGACATCTAACTGGGTTGTCCATACGGATGCCGGAGAAGAACCATTGATGATCTCGTGGGATCAGTCTCCGCTTGCTTTGGAAACGCTAAACTCACCGACGAGATCTTGCATCGGCCAGGTTCCGGCAACCATGAACCTTGCAACGGCATTGGCCGCAGACCG...

Protein

Download Protein FASTA

189 aa · TkA01G503660|TK1151|PROTEIN

MQGREKRRWPSWKNLKRRVGTGWKRINIMGCCGTSNWVVHTDAGEEPLMISWDQSPLALETLNSPTRSCIGQVPATMNLATALAADRRQLNVGPTDEMKTKPLKSIVRLFEGIDGGDVKVAEGDADADDDGSDVRGIGKLCCLCTERNKGAALIPCGHTYCRVCSRAMWSKHGTCPLCNRSITEILEIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G503660`
TK1151 ID	TkA01G503660
OH-1004 ID	LXL04_001854
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G503660`
Location	Chr01:126119635-126121124 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001854` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006301 DNA damage tolerance Biological Process GO:0006513 protein monoubiquitination Biological Process GO:0016567 protein ubiquitination Biological Process GO:0005634 nucleus Cellular Component GO:0097505 Rad6-Rad18 complex Cellular Component GO:0003697 single-stranded DNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function GO:0061630 ubiquitin protein ligase activity Molecular Function
KEGG gene cross-reference	dosa:Os07g0446100 kla:KLLA0_C08756g These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.351

Rank 1 · TkA01G503660 · TK1151

Cytoplasm0.336

Rank 2 · TkA01G503660 · TK1151

Cell membrane0.280

Rank 3 · TkA01G503660 · TK1151

Endoplasmic reticulum0.129

Rank 4 · TkA01G503660 · TK1151

Golgi apparatus0.103

Rank 5 · TkA01G503660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30552CFAP251_N25-55 aa

PF13445zf-RING_UBOX59-69 aa

PF00851Peptidase_C6130-169 aa

PF13920zf-C3HC4_3139-184 aa

PF13639zf-RING_2140-179 aa

PF24921RING_XB3-XBAT31140-182 aa

PF12678zf-rbx1140-179 aa

PF14447Prok-RING_4141-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G503660	`PF30552`	CFAP251_N	25	55	0.17	11.7
TkA01G503660	`PF13445`	zf-RING_UBOX	59	69	0.074	13.8
TkA01G503660	`PF00851`	Peptidase_C6	130	169	0.3	10.7
TkA01G503660	`PF13920`	zf-C3HC4_3	139	184	3.9e-11	43.3
TkA01G503660	`PF13639`	zf-RING_2	140	179	9.9e-06	26.4
TkA01G503660	`PF24921`	RING_XB3-XBAT31	140	182	0.0027	18.4
TkA01G503660	`PF12678`	zf-rbx1	140	179	0.38	11.8
TkA01G503660	`PF14447`	Prok-RING_4	141	183	2e-07	31.5
TkA01G503660	`PF00097`	zf-C3HC4	141	178	1.5e-06	28.7
TkA01G503660	`PF13923`	zf-C3HC4_2	141	178	4.3e-05	24.0
TkA01G503660	`PF14634`	zf-RING_5	141	180	0.0075	16.9
TkA01G503660	`PF13445`	zf-RING_UBOX	141	176	0.074	13.8
TkA01G503660	`PF15227`	zf-C3HC4_4	144	178	0.41	11.5
TkA01G503660	`PF14570`	zf-RING_4	147	180	0.1	13.1
TkA01G503660	`PF30124`	F10E9_2_M	153	165	0.026	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card