TkA01G499130 | RubberDandelionOmics

Gene overview

TkA01G499130

Reference: TK1151 Chr: Chr01 Coordinates: 125058743-125060942 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1071 bp · TkA01G499130|TK1151|cDNA

ATGGGTTTTAAGTTCAATCAAAGTTTTTCTTTTTCTCTTCTTCTACTCATCAATATTCTTCTTGTGTTTGTTGATGGAGAAGATGATAAGATAACTTGTGATGTATTCAAAGGGAGTTGGGTCGTGGACGAATCATATCCGCTCTACAATGCATCATCATTTTGCCCGTTTGTTGGCAAAGAGTTTGATTGTGTCAAAAATGGTCGTCCTGATCAACTCTATCTCAAGTATCGATGGCAACCCCATGATTGCTCCTTATC...

CDS

Download CDS FASTA

1071 bp · TkA01G499130|TK1151|CDS

ATGGGTTTTAAGTTCAATCAAAGTTTTTCTTTTTCTCTTCTTCTACTCATCAATATTCTTCTTGTGTTTGTTGATGGAGAAGATGATAAGATAACTTGTGATGTATTCAAAGGGAGTTGGGTCGTGGACGAATCATATCCGCTCTACAATGCATCATCATTTTGCCCGTTTGTTGGCAAAGAGTTTGATTGTGTCAAAAATGGTCGTCCTGATCAACTCTATCTCAAGTATCGATGGCAACCCCATGATTGCTCCTTATC...

Protein

Download Protein FASTA

356 aa · TkA01G499130|TK1151|PROTEIN

MGFKFNQSFSFSLLLLINILLVFVDGEDDKITCDVFKGSWVVDESYPLYNASSFCPFVGKEFDCVKNGRPDQLYLKYRWQPHDCSLSRFDGEKFLEKMKGKTIMFVGDSLSKNHWLSLLCMIHSAVPSARYAVKLSMADGMTTYTFLDYDMKVMYHHSLYLVDIVEEKIGRVLKLDSITSGKLWLNMDYLVFNTWHWWTRRGPTQPFDFIQDGDKVFKDMDRVVAFGKAIDTWGRWVDDNINPVKSKVFFQGISPTHYNG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G499130`
TK1151 ID	TkA01G499130
OH-1004 ID	LXL04_001909
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.187 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G499130

Location Chr01:125058743-125060942 (+)

Description Similar to TBL41: Protein trichome birefringence-like 41

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14850`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g42570`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g29050`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g34070`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g31110`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001909 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0009867 jasmonic acid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29050

ath:AT2G31110

ath:AT2G34070

ath:AT2G42570

ath:AT3G14850

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.423

Rank 1 · TkA01G499130 · TK1151

Extracellular0.126

Rank 2 · TkA01G499130 · TK1151

Endoplasmic reticulum0.088

Rank 3 · TkA01G499130 · TK1151

Cell membrane0.073

Rank 4 · TkA01G499130 · TK1151

Lysosome / Vacuole0.055

Rank 5 · TkA01G499130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416PMR5N32-85 aa

PF24536NXPE4_C79-122 aa

PF13839PC-Esterase86-353 aa

PF14416PMR5N234-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G499130	`PF14416`	PMR5N	32	85	2.2e-22	79.9
TkA01G499130	`PF24536`	NXPE4_C	79	122	0.033	14.5
TkA01G499130	`PF13839`	PC-Esterase	86	353	3.8e-87	293.5
TkA01G499130	`PF14416`	PMR5N	234	242	2.2e-22	79.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IWA8`	Arabidopsis thaliana	sp\|F4IWA8\|TBL41_ARATH Protein trichome birefringence-like 41	59.100%	Swiss-Prot	High
`Q9SIN2`	Arabidopsis thaliana	sp\|Q9SIN2\|TBL39_ARATH Protein trichome birefringence-like 39	52.200%	Swiss-Prot	High
`Q8VY22`	Arabidopsis thaliana	sp\|Q8VY22\|TBL38_ARATH Protein trichome birefringence-like 38	53.000%	Swiss-Prot	High
`O22960`	Arabidopsis thaliana	sp\|O22960\|TBL37_ARATH Protein trichome birefringence-like 37	52.300%	Swiss-Prot	High
`Q67XC4`	Arabidopsis thaliana	sp\|Q67XC4\|TBL40_ARATH Protein trichome birefringence-like 40	50.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card