TkA01G498870 | RubberDandelionOmics

Gene overview

TkA01G498870

Reference: TK1151 Chr: Chr01 Coordinates: 125002097-125003728 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

336 bp · TkA01G498870|TK1151|cDNA

ATGGTTCTGATCAGATCTGGTGACACTTTCTGTCTGTCGCGAAAGATGGGTGACAACATTCCTCCTCCTCCACCACCCAACTCTAATAACTTCTCCCTGCTCTCGATGCTCAGTCGTGAGAAACTTAATGGATCAAATTTCTTGGATTGGTCTCAAGCCTTAAGGATTGCCCTAAGGTACGAGGACAAGGAGTATTTGATCGACCATGATCTCCCCTATCTCGATGAAGAATGCACTGAAGAAGAAAAGAAAGTATACAA...

CDS

Download CDS FASTA

336 bp · TkA01G498870|TK1151|CDS

ATGGTTCTGATCAGATCTGGTGACACTTTCTGTCTGTCGCGAAAGATGGGTGACAACATTCCTCCTCCTCCACCACCCAACTCTAATAACTTCTCCCTGCTCTCGATGCTCAGTCGTGAGAAACTTAATGGATCAAATTTCTTGGATTGGTCTCAAGCCTTAAGGATTGCCCTAAGGTACGAGGACAAGGAGTATTTGATCGACCATGATCTCCCCTATCTCGATGAAGAATGCACTGAAGAAGAAAAGAAAGTATACAA...

Protein

Download Protein FASTA

111 aa · TkA01G498870|TK1151|PROTEIN

MVLIRSGDTFCLSRKMGDNIPPPPPPNSNNFSLLSMLSREKLNGSNFLDWSQALRIALRYEDKEYLIDHDLPYLDEECTEEEKKVYNDHDTESRKVACIMMASMTSELQKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G498870`
TK1151 ID	TkA01G498870
OH-1004 ID	LXL04_020646
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.000
Protein coverage (%)	TK1151 86.486 / OH-1004 16.608 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G498870`
Location	Chr01:125002097-125003728 (+)
Description	Similar to RHO1: Rac-like GTP-binding protein RHO1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_020646` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007015 actin filament organization Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0007165 signal transduction Biological Process GO:0007264 small GTPase-mediated signal transduction Biological Process GO:0008360 regulation of cell shape Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009860 pollen tube growth Biological Process GO:0017157 regulation of exocytosis Biological Process GO:0030833 regulation of actin filament polymerization Biological Process GO:0030834 regulation of actin filament depolymerization Biological Process GO:0030865 cortical cytoskeleton organization Biological Process
KEGG gene cross-reference	ath:AT2G17800 ath:AT3G51300 ath:AT4G35950 bvg:104895157 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · TkA01G498870 · TK1151

Nucleus0.211

Rank 2 · TkA01G498870 · TK1151

Plastid0.193

Rank 3 · TkA01G498870 · TK1151

Endoplasmic reticulum0.123

Rank 4 · TkA01G498870 · TK1151

Mitochondrion0.100

Rank 5 · TkA01G498870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14244Retrotran_gag_340-63 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G498870	`PF14244`	Retrotran_gag_3	40	63	0.064	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card