Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2800 bp · TkA01G493400|TK1151|cDNA
TGGGACTGCGACTATGTGGTTTTACCATCCTCCCTGTACCCTAAATAACGGCTTTTTTTACAGAATTTCTGCCAAATATTTACAGGAATCAGACAACTTTTCATTTCCATTTGTTTCTTTCTTGAATCTTGATCCCCTTTCAAGCTCCTTGAATTTCACACCCAGTGCTTAATTCAACCCCACAAACCCTAAACTCCTGCTTCAATCCAAGCCCTAATAAGTGAATTCACAAGCATCCCAAGATTAAGGTGAGTGAATTG...
1536 bp · TkA01G493400|TK1151|CDS
ATGGCACCAGAAGTGATTCAAAATTCTGAGGGATATAATGAAAAGGCAGATATTTGGTCTTTAGGAATCACTGCAATTGAGATGGCAAAAGGGGAGCCTCCACTTGCTGACCTTCATCCAATGAGAGTCCTTTTCATCATACCTAGAGAAAACCCACCCCAGCTAGATGAACATTTTTCTCGTCCAATGAAAGAATTTGTTTCATTGTGTTTAAAAAAGTCGCCCTCTGAGAGACCAAGTGCAAAGGAACTTCTGAAACA...
Protein
Download Protein FASTA511 aa · TkA01G493400|TK1151|PROTEIN
MAPEVIQNSEGYNEKADIWSLGITAIEMAKGEPPLADLHPMRVLFIIPRENPPQLDEHFSRPMKEFVSLCLKKSPSERPSAKELLKHRFIKNARKNPRLLERIRERPKFQIKEDGESPRNGTQALGEGSSTVKITRVEDTVRVSNNQGKTVRNAGWDFSIGGGSTGTVRSSVRPPQIRDRKTDNQPTTQKRVTETGGTRRSSEASRRDHDKKQDSYYRGDEDMNMSMDGSGTVVVRSPRAQTSSLFSDQSTMSSSTYSSL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G493400 |
|---|---|
| TK1151 ID | TkA01G493400 |
| OH-1004 ID | LXL04_001969 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 72.585Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G493400 |
|---|---|
| Location | Chr01:123471381-123476625 (+) |
| Description | Similar to svkA: Serine/threonine-protein kinase svkA |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006468 protein phosphorylation Biological Process GO:0006972 hyperosmotic response Biological Process GO:0007165 signal transduction Biological Process GO:0009267 cellular response to starvation Biological Process GO:0030336 negative regulation of cell migration Biological Process GO:0032956 regulation of actin cytoskeleton organization Biological Process GO:0034599 cellular response to oxidative stress Biological Process GO:0035329 hippo signaling Biological Process GO:0035556 intracellular signal transduction Biological Process GO:0043547 positive regulation of GTPase activity Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0051301 cell division Biological Process |
| KEGG gene cross-reference | cel:CELE_T19A5.2 ddi:DDB_G0286359 hsa:8428 mmu:223255 rno:361092 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00069Pkinase1-90 aaPF07714PK_Tyr_Ser-Thr1-86 aaPF20929PDCD10_N383-436 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G493400 | PF00069 | Pkinase | 1 | 90 | 5.2e-17 | 62.8 |
| TkA01G493400 | PF07714 | PK_Tyr_Ser-Thr | 1 | 86 | 9e-13 | 48.8 |
| TkA01G493400 | PF20929 | PDCD10_N | 383 | 436 | 0.19 | 12.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.