TkA01G492590 | RubberDandelionOmics

Gene overview

TkA01G492590

Reference: TK1151 Chr: Chr01 Coordinates: 123282348-123283628 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1128 bp · TkA01G492590|TK1151|cDNA

CCCCTTCAACCCTCTTTCCGTCACCATACTCAAACCGCCGCCACCACCCAGGGCGGGTTCTTTAACCACGACGAGATAGAGAGACGTACAGAAATAGAGAAAGGGAGACGAACAGGATCGAGAGGGAGAGAGGATAGTCGGAGGTCTTGTCGGAGGACATCTGGTAGCGGATGTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGCTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTTGTTCTCGT...

CDS

Download CDS FASTA

597 bp · TkA01G492590|TK1151|CDS

CCCCTTCAACCCTCTTTCCGTCACCATACTCAAACCGCCGCCACCACCCAGGGCGGGTTCTTTAACCACGACGAGATAGAGAGACGTACAGAAATAGAGAAAGGGAGACGAACAGGATCGAGAGGGAGAGAGGATAGTCGGAGGTCTTGTCGGAGGACATCTGGTAGCGGATGTGTCAACAACTCGAAGCTTTCATTTCATCAAGACAATGGCTCAATGCACGTTGGAACCACCGTTTGGCCTGCTTCACTTGTTCTCGT...

Protein

Download Protein FASTA

198 aa · TkA01G492590|TK1151|PROTEIN

PLQPSFRHHTQTAATTQGGFFNHDEIERRTEIEKGRRTGSRGREDSRRSCRRTSGSGCVNNSKLSFHQDNGSMHVGTTVWPASLVLVKFAERWLSSTSTTDNPYATVLLFHNKRAIELGTGCGVAAMGVYLLGLKDVVLTDIAPVMPALKHNLKRNKTVLGKMLKMAQLHWTNSEQIKALKPPFDIVIAADVVYIEES

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G492590`
TK1151 ID	TkA01G492590
OH-1004 ID	LXL04_002002
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.400
Protein coverage (%)	TK1151 100.000 / OH-1004 89.340 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G492590`
Location	Chr01:123282348-123283628 (+)
Description	Similar to VCPKMT: Protein-lysine methyltransferase METTL21D
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002002` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002239 response to oomycetes Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0009630 gravitropism Biological Process GO:0009651 response to salt stress Biological Process GO:0009733 response to auxin Biological Process GO:0009734 auxin-activated signaling pathway Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009787 regulation of abscisic acid-activated signaling pathway Biological Process GO:0010928 regulation of auxin mediated signaling pathway Biological Process
KEGG gene cross-reference	ath:AT4G35987 cel:CELE_C42C1.13 mmu:207965 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.512

Rank 1 · TkA01G492590 · TK1151

Cytoplasm0.404

Rank 2 · TkA01G492590 · TK1151

Mitochondrion0.098

Rank 3 · TkA01G492590 · TK1151

Cell membrane0.051

Rank 4 · TkA01G492590 · TK1151

Endoplasmic reticulum0.045

Rank 5 · TkA01G492590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10294Methyltransf_1660-197 aa

PF13489Methyltransf_23110-193 aa

PF06325PrmA112-189 aa

PF08242Methyltransf_12120-193 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G492590	`PF10294`	Methyltransf_16	60	197	3.8e-22	79.6
TkA01G492590	`PF13489`	Methyltransf_23	110	193	0.21	12.0
TkA01G492590	`PF06325`	PrmA	112	189	0.00017	21.9
TkA01G492590	`PF08242`	Methyltransf_12	120	193	0.0052	18.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card