TkA01G490230 | RubberDandelionOmics

Gene overview

TkA01G490230

Reference: TK1151 Chr: Chr01 Coordinates: 122691664-122692914 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

938 bp · TkA01G490230|TK1151|cDNA

GAAGAAGTATAAGAACACTCATGTATTCATGCGATTTACAGTGCGGCACAATGAAAGTAATTTTTCTAGCGGTACCAACCACAGAAAAGGACAAATTAATCTGTCAAGTAGTTAATTGATGCTAAATTACTACTAGTAGTGTGCCAACACACTTGTCATCACCTCTTGCCTCTTGCAATACACTTTTCCCTGTTTCAGAGCAAAATGATGAGAGCTGTGTGTTTCATTGTACTATGTGCCCTAATCTTATCATCTCAAGC...

CDS

Download CDS FASTA

516 bp · TkA01G490230|TK1151|CDS

ATGATGAGAGCTGTGTGTTTCATTGTACTATGTGCCCTAATCTTATCATCTCAAGCAAGATCAAGCATCAAAAAACCACTACCAAATCCCAACTTTGAAATCAACTCTGCTAATCATCAGAACGAAGGAACCTGTTCGTTCACGGTAAGGCTTGTAACAAGCTGTTCTTCCGTTCCGTACACCCGAGATGAAATCAGTATCTCCTTCGGCGATGCTTACGGCAACCAGGTTTACGCTCCGAGACTAGACGACCCGTCGAC...

Protein

Download Protein FASTA

171 aa · TkA01G490230|TK1151|PROTEIN

MMRAVCFIVLCALILSSQARSSIKKPLPNPNFEINSANHQNEGTCSFTVRLVTSCSSVPYTRDEISISFGDAYGNQVYAPRLDDPSTRTFERCSADTFEVYGPCTYQICYMYVYRSGYDGWLPERVEVYGYNKEAVSFDYKDWIPSDMWYGYNYCSPYAVDAVSSSKSVMK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G490230`
TK1151 ID	TkA01G490230
OH-1004 ID	LXL04_002016
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G490230

Location Chr01:122691664-122692914 (-)

Description Similar to ATS3B: Embryo-specific protein ATS3B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62200`	May play a role during embryo development.	No verified direct reference in this release
`At2g41475`	May play a role during embryo development.	No verified direct reference in this release
`At5g07190`	May play a role during embryo development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002016 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G41475

ath:AT5G07190

ath:AT5G62200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.525

Rank 1 · TkA01G490230 · TK1151

Endoplasmic reticulum0.105

Rank 2 · TkA01G490230 · TK1151

Plastid0.102

Rank 3 · TkA01G490230 · TK1151

Cell membrane0.092

Rank 4 · TkA01G490230 · TK1151

Cytoplasm0.074

Rank 5 · TkA01G490230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28761CLE7-22 aa

PF06232ATS335-155 aa

PF01477PLAT48-147 aa

PF30760GtfB_N118-127 aa

PF30760GtfB_N128-154 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G490230	`PF28761`	CLE	7	22	0.19	12.6
TkA01G490230	`PF06232`	ATS3	35	155	4.2e-49	166.3
TkA01G490230	`PF01477`	PLAT	48	147	4.6e-06	28.0
TkA01G490230	`PF30760`	GtfB_N	118	127	0.21	12.3
TkA01G490230	`PF30760`	GtfB_N	128	154	0.21	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPM5`	Arabidopsis thaliana	sp\|Q6NPM5\|ATS3B_ARATH Embryo-specific protein ATS3B	62.800%	Swiss-Prot	Medium
`Q681K2`	Arabidopsis thaliana	sp\|Q681K2\|ATS3A_ARATH Embryo-specific protein ATS3A	54.100%	Swiss-Prot	High
`Q9LYP6`	Arabidopsis thaliana	sp\|Q9LYP6\|ATS3_ARATH Embryo-specific protein ATS3	45.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card