TkA01G489520 | RubberDandelionOmics

Gene overview

TkA01G489520

Reference: TK1151 Chr: Chr01 Coordinates: 122484801-122489178 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1426 bp · TkA01G489520|TK1151|cDNA

ATATAAAGCAGTGCATACCCCTTGATCCATATTCACACTAAACTAGAAACATTCATCATTCTCCCTCTCTTTCTCTCTCTAACAGAAAAATGCAGAAGCTCTCTGCAGTTCTAGTAGTGGTGCTCCTATGCGCAACCTCCAATGGCGTTCTGTCCTTCACTGACGGAATATTACCAAACGGTCAATTCGAATACGGCCCAAAACCTCACCAAATGAAAGGCACAAAAGTGATCGATCCAAAAGCAATCGCAAATTGGGAA...

CDS

Download CDS FASTA

1125 bp · TkA01G489520|TK1151|CDS

ATGCAGAAGCTCTCTGCAGTTCTAGTAGTGGTGCTCCTATGCGCAACCTCCAATGGCGTTCTGTCCTTCACTGACGGAATATTACCAAACGGTCAATTCGAATACGGCCCAAAACCTCACCAAATGAAAGGCACAAAAGTGATCGATCCAAAAGCAATCGCAAATTGGGAACTCACGGGATTCGTTGAGTACATAAAATCAGGCCAAAAACAAGGTGACATGTTATTGGTAGTACCCGATGGTGCCTATGCTGTAAGACT...

Protein

Download Protein FASTA

374 aa · TkA01G489520|TK1151|PROTEIN

MQKLSAVLVVVLLCATSNGVLSFTDGILPNGQFEYGPKPHQMKGTKVIDPKAIANWELTGFVEYIKSGQKQGDMLLVVPDGAYAVRLGEDASIKTKVDVKKGLFYSITFNVARTCAQEEKLNVSVSPNSEKNDWGILPMQTMYSSNGWDTYSWGFLAEANKIEIVIHNPLSVEKDPACGPLIDSVALKALFPPRRTNTNMLKNGDFEEGPFVLPKTDVGGVLIPPNIEDDHSPLPGWMIESLKAVKYLDSEHFAIPKGKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G489520`
TK1151 ID	TkA01G489520
OH-1004 ID	LXL04_002031
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G489520

Location Chr01:122484801-122489178 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g11420`	Together with BIIDXI, acts as a positive regulator of PME3 activity during several developmental processes, including seed germination and endosperm (testa) rupture at the micropyle, probably by modulating the pectin status in cell walls.	BIIDXI, the At4g32460 DUF642 gene, is involved in pectin methyl esterase regulation during Arabidopsis thaliana seed germination and plant development.2014 · DOI: 10.1186/s12870-014-0338-8
`At4g32460`	May positively regulate PME3 activity in cell-wall pectin modification and associated development.	BIIDXI, the At4g32460 DUF642 gene, is involved in pectin methyl esterase regulation during Arabidopsis thaliana seed germination and plant development.2014 · DOI: 10.1186/s12870-014-0338-8 Cell Wall Localization of Two DUF642 Proteins, BIIDXI and TEEBE, during Meloidogyne incognita Early Inoculation.2017 · DOI: 10.5423/ppj.nt.05.2017.0101
`At5g25460`	Involved in the regulation of testa rupture during seed germination.	Analysis of two L-Galactono-1,4-lactone-responsive genes with complementary expression during the development of Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcs014
`At1g80240`	Protein DUF642 L-GALACTONO-1,4-LACTONE-RESPONSIVE GENE 1.	No verified direct reference in this release
`At2g41800`	Prevents hypocotyl epidermal cells elongation by modulating the pectin status in cell walls.	Cell Wall Localization of Two DUF642 Proteins, BIIDXI and TEEBE, during Meloidogyne incognita Early Inoculation.2017 · DOI: 10.5423/ppj.nt.05.2017.0101

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009624 response to nematode Biological Process

GO:0009630 gravitropism Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009845 seed germination Biological Process

GO:0010015 root morphogenesis Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0048598 embryonic morphogenesis Biological Process

GO:0048608 reproductive structure development Biological Process

KEGG gene cross-reference

ath:AT1G80240

ath:AT2G41800

ath:AT4G32460

ath:AT5G11420

ath:AT5G25460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.539

Rank 1 · TkA01G489520 · TK1151

Cell membrane0.150

Rank 2 · TkA01G489520 · TK1151

Cytoplasm0.109

Rank 3 · TkA01G489520 · TK1151

Endoplasmic reticulum0.104

Rank 4 · TkA01G489520 · TK1151

Golgi apparatus0.092

Rank 5 · TkA01G489520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04862DUF64226-188 aa

PF00031Cystatin96-126 aa

PF04862DUF642200-365 aa

PF00031Cystatin276-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G489520	`PF04862`	DUF642	26	188	1.5e-82	275.7
TkA01G489520	`PF00031`	Cystatin	96	126	0.34	11.9
TkA01G489520	`PF04862`	DUF642	200	365	1.5e-82	275.7
TkA01G489520	`PF00031`	Cystatin	276	294	0.34	11.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYE7`	Arabidopsis thaliana	sp\|Q9LYE7\|B2DXL_ARATH BIIDXI-like protein At5g11420	67.600%	Swiss-Prot	High
`Q8LAR0`	Arabidopsis thaliana	sp\|Q8LAR0\|B2DXI_ARATH Protein BIIDXI	65.700%	Swiss-Prot	High
`Q94F20`	Arabidopsis thaliana	sp\|Q94F20\|DGR2_ARATH Protein DUF642 L-GALACTONO-1,4-LACTONE-RESPONSIVE GENE 2	66.500%	Swiss-Prot	High
`Q9SSB7`	Arabidopsis thaliana	sp\|Q9SSB7\|DGR1_ARATH Protein DUF642 L-GALACTONO-1,4-LACTONE-RESPONSIVE GENE 1	62.100%	Swiss-Prot	High
`O22940`	Arabidopsis thaliana	sp\|O22940\|TEEBE_ARATH Protein TEEBE	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card