TkA01G484530 | RubberDandelionOmics

Gene overview

TkA01G484530

Reference: TK1151 Chr: Chr01 Coordinates: 121272989-121274776 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

546 bp · TkA01G484530|TK1151|cDNA

AGATACGAGCCACGATTAAAACAACCTCTTAATTATAAAACATCTTCTAAGCAGGTAAGAGACGAAGAAGGAAGAAGAAGGTTTCATGGGGCATTTAGTGGAGGATTCTCTGCTAGTTACTACAATACCGTGGGATCTAAAGAGGGATGGACTCCACAATCATTTACATCGTCAAGGATGAACAGAGCTGAAATTAAGCAGCAAGATCTCTCTAACTTTTTGGATGACGATGAGAAAGCTGAACTGGAAGGCAATTCTTT...

CDS

Download CDS FASTA

546 bp · TkA01G484530|TK1151|CDS

AGATACGAGCCACGATTAAAACAACCTCTTAATTATAAAACATCTTCTAAGCAGGTAAGAGACGAAGAAGGAAGAAGAAGGTTTCATGGGGCATTTAGTGGAGGATTCTCTGCTAGTTACTACAATACCGTGGGATCTAAAGAGGGATGGACTCCACAATCATTTACATCGTCAAGGATGAACAGAGCTGAAATTAAGCAGCAAGATCTCTCTAACTTTTTGGATGACGATGAGAAAGCTGAACTGGAAGGCAATTCTTT...

Protein

Download Protein FASTA

181 aa · TkA01G484530|TK1151|PROTEIN

RYEPRLKQPLNYKTSSKQVRDEEGRRRFHGAFSGGFSASYYNTVGSKEGWTPQSFTSSRMNRAEIKQQDLSNFLDDDEKAELEGNSLGTSMKFDTFGFTAADMARKHVEKEQNERPSAIPGPAPDEIVVPATDPIGVFTRLKVVVGLDMEVAATPMPEFYQNKLVPVEDGHFAKMGKMMGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G484530`
TK1151 ID	TkA01G484530
OH-1004 ID	LXL04_002078
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 64.088 / OH-1004 86.567 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G484530

Location Chr01:121272989-121274776 (-)

Description Similar to TGH: G patch domain-containing protein TGH

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23080`	Functions as a component of microRNA (miRNA) and small interfering RNA (siRNA) biogenesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8B2G4`	Functions as a component of microRNA (miRNA) and small interfering RNA (siRNA) biogenesis.	No verified direct reference in this release
`Os06g0489200`	Functions as a component of microRNA (miRNA) and small interfering RNA (siRNA) biogenesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002078 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0030422 siRNA processing Biological Process

GO:0031047 regulatory ncRNA-mediated gene silencing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0071013 catalytic step 2 spliceosome Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0070878 primary miRNA binding Molecular Function

GO:0070883 pre-miRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G23080

bta:518738

dosa:Os06g0489200

mmu:67471

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.656

Rank 1 · TkA01G484530 · TK1151

Cytoplasm0.425

Rank 2 · TkA01G484530 · TK1151

Mitochondrion0.034

Rank 3 · TkA01G484530 · TK1151

Cell membrane0.022

Rank 4 · TkA01G484530 · TK1151

Endoplasmic reticulum0.021

Rank 5 · TkA01G484530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07713DUF160414-89 aa

PF14599zinc_ribbon_6147-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G484530	`PF07713`	DUF1604	14	89	9.1e-32	109.4
TkA01G484530	`PF14599`	zinc_ribbon_6	147	166	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXN9`	Arabidopsis thaliana	sp\|Q8GXN9\|TGH_ARATH G patch domain-containing protein TGH	69.800%	Swiss-Prot	Medium
`B8B2G4`	Oryza sativa subsp. indica	sp\|B8B2G4\|TGHH_ORYSI G patch domain-containing protein TGH homolog	67.500%	Swiss-Prot	Medium
`Q67VW6`	Oryza sativa subsp. japonica	sp\|Q67VW6\|TGHH_ORYSJ G patch domain-containing protein TGH homolog	67.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card