TkA01G483780 | RubberDandelionOmics

Gene overview

TkA01G483780

Reference: TK1151 Chr: Chr01 Coordinates: 121090873-121094125 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1994 bp · TkA01G483780|TK1151|cDNA

GTTTTAGCCTTATTCTCATGCTTTCAGCTTCTATGACACTCTTGCCATCTTTGGTGTGAGAAAATGCAATGAGTCCTTTGAAAAGCGGGTTTTTGCTTTACTCTGGCAACCGATTGTTAACCAATGCTGCTAGTAGGTCTGGTGGCTCCGCCGCCAATGTCTTCTCCTGCTCCCGAAACTTCTCCTCCTTCACCTCTCGATCCGTCAGTAGGCAACATTACTACTCCTCCGGCAGCGACCTTTCCCCTCCTTCCTCCGAC...

CDS

Download CDS FASTA

1632 bp · TkA01G483780|TK1151|CDS

ATGCTGCTAGTAGGTCTGGTGGCTCCGCCGCCAATGTCTTCTCCTGCTCCCGAAACTTCTCCTCCTTCACCTCTCGATCCGTCAGTAGGCAACATTACTACTCCTCCGGCAGCGACCTTTCCCCTCCTTCCTCCGACAAATACCTCTATTGGTTCTGAACCTACTCTTTCGCCGCCGTCGCAAAATCGATCTAGTAGTAACAGTGCATTAGTTGCGCTTGGAGTTGGAATAGGCATTGGAGGGGCAGTTGTGCTTGTGTT...

Protein

Download Protein FASTA

543 aa · TkA01G483780|TK1151|PROTEIN

MLLVGLVAPPPMSSPAPETSPPSPLDPSVGNITTPPAATFPLLPPTNTSIGSEPTLSPPSQNRSSSNSALVALGVGIGIGGAVVLVFVGVFVVWYKRRKRRRRALSESSAPLGFKDDFGTAPHNWQPLNAPSTKDNITNSPLNNGSCFQLPSMGPPHSTSSAGSEKPTMAYPNSKTIFTYEELATATQGFSQVNLLGQGGFGYVHKGVLPNGEKVAIKQLKIGSGQGEREFQAEVAIISRVHHKHLVTLVGYCISGIQRM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483780`
TK1151 ID	TkA01G483780
OH-1004 ID	LXL04_002090
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 99.816 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483780

Location Chr01:121090873-121094125 (-)

Description Similar to PERK1: Proline-rich receptor-like protein kinase PERK1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24550`	Proline-rich receptor-like protein kinase PERK1.	No verified direct reference in this release
`At1g52290`	Proline-rich receptor-like protein kinase PERK15.	No verified direct reference in this release
`At4g34440`	Proline-rich receptor-like protein kinase PERK5.	No verified direct reference in this release
`At3g18810`	Putative proline-rich receptor-like protein kinase PERK6.	No verified direct reference in this release
`At2g18470`	Required during abscisic acid (ABA)-mediated activation of Ca(2+) channels.	Plasma membrane-associated proline-rich extensin-like receptor kinase 4, a novel regulator of Ca signalling, is required for abscisic acid responses in Arabidopsis thaliana.2009 · DOI: 10.1111/j.1365-313x.2009.03956.x Arabidopsis proline-rich extensin-like receptor kinase 4 modulates the early event toward abscisic acid response in root tip growth.2009 · DOI: 10.4161/psb.4.11.9739

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002090 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0009620 response to fungus Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048364 root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G52290

ath:AT2G18470

ath:AT3G24550

ath:AT4G34440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.850

Rank 1 · TkA01G483780 · TK1151

Cytoplasm0.112

Rank 2 · TkA01G483780 · TK1151

Nucleus0.083

Rank 3 · TkA01G483780 · TK1151

Endoplasmic reticulum0.061

Rank 4 · TkA01G483780 · TK1151

Golgi apparatus0.023

Rank 5 · TkA01G483780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12104Tcell_CD4_C80-103 aa

PF14316DUF438182-106 aa

PF00069Pkinase191-458 aa

PF07714PK_Tyr_Ser-Thr193-462 aa

PF03109ABC1196-220 aa

PF12104Tcell_CD4_C246-255 aa

PF03109ABC1300-343 aa

PF17667Pkinase_fungal301-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483780	`PF12104`	Tcell_CD4_C	80	103	0.11	13.4
TkA01G483780	`PF14316`	DUF4381	82	106	0.29	12.2
TkA01G483780	`PF00069`	Pkinase	191	458	2e-43	149.4
TkA01G483780	`PF07714`	PK_Tyr_Ser-Thr	193	462	3.4e-46	158.4
TkA01G483780	`PF03109`	ABC1	196	220	7.4e-05	22.7
TkA01G483780	`PF12104`	Tcell_CD4_C	246	255	0.11	13.4
TkA01G483780	`PF03109`	ABC1	300	343	7.4e-05	22.7
TkA01G483780	`PF17667`	Pkinase_fungal	301	363	0.1	12.0
TkA01G483780	`PF14316`	DUF4381	435	502	0.29	12.2
TkA01G483780	`PF12104`	Tcell_CD4_C	441	462	0.11	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LV48`	Arabidopsis thaliana	sp\|Q9LV48\|PERK1_ARATH Proline-rich receptor-like protein kinase PERK1	67.600%	Swiss-Prot	Medium
`Q9C821`	Arabidopsis thaliana	sp\|Q9C821\|PEK15_ARATH Proline-rich receptor-like protein kinase PERK15	67.100%	Swiss-Prot	Medium
`Q8GX23`	Arabidopsis thaliana	sp\|Q8GX23\|PERK5_ARATH Proline-rich receptor-like protein kinase PERK5	60.900%	Swiss-Prot	High
`Q9LS95`	Arabidopsis thaliana	sp\|Q9LS95\|PERK6_ARATH Putative proline-rich receptor-like protein kinase PERK6	66.900%	Swiss-Prot	Medium
`Q9ZNQ8`	Arabidopsis thaliana	sp\|Q9ZNQ8\|PERK4_ARATH Proline-rich receptor-like protein kinase PERK4	65.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card