TkA01G483580 | RubberDandelionOmics

Gene overview

TkA01G483580

Reference: TK1151 Chr: Chr01 Coordinates: 121054046-121054696 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkA01G483580|TK1151|cDNA

ATGGCGACTCTTCATGTAGATTCAGCCCTTGACTTCATCCGACACCACCTTCTCAATGATTACGAAGCCCCTGATTGCTCCCCCGAGCCATCGATTTCTGGATCTGGACTATCAGTATTTGATTATCTCGACTTTCAGGAAGAAACCACGTCCCAATTCATGGTTCCAGAGTCGATTGATAGTAGATCTGGACAATCATATCTGAAAGAAACCGAGTGCGTTGAGGAGGCTCAGGCGAACGTACACTACAGAGGAGTACG...

CDS

Download CDS FASTA

651 bp · TkA01G483580|TK1151|CDS

ATGGCGACTCTTCATGTAGATTCAGCCCTTGACTTCATCCGACACCACCTTCTCAATGATTACGAAGCCCCTGATTGCTCCCCCGAGCCATCGATTTCTGGATCTGGACTATCAGTATTTGATTATCTCGACTTTCAGGAAGAAACCACGTCCCAATTCATGGTTCCAGAGTCGATTGATAGTAGATCTGGACAATCATATCTGAAAGAAACCGAGTGCGTTGAGGAGGCTCAGGCGAACGTACACTACAGAGGAGTACG...

Protein

Download Protein FASTA

216 aa · TkA01G483580|TK1151|PROTEIN

MATLHVDSALDFIRHHLLNDYEAPDCSPEPSISGSGLSVFDYLDFQEETTSQFMVPESIDSRSGQSYLKETECVEEAQANVHYRGVRRRPWGKYAAEIRDPKRSGRRVWLGTFDTSIEAAKAYDRAAFEMRGRKAILNFPLEIGNSRSDTVAIAGGCRKRIRDVEQMVVEVKKEKIVETVDVPLTPSSWKVIWDEDWYGLLNGHLLSPISGGLMAN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483580`
TK1151 ID	TkA01G483580
OH-1004 ID	LXL04_002096
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 99.074 / OH-1004 39.266 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483580

Location Chr01:121054046-121054696 (+)

Description Similar to HPPR: Hydroxyphenylpyruvate reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61600`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g47230`	Acts as a transcriptional activator.	Arabidopsis ethylene-responsive element binding factors act as transcriptional activators or repressors of GCC box-mediated gene expression.2000 · DOI: 10.1105/tpc.12.3.393

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009853 photorespiration Biological Process

GO:0009854 oxidative photosynthetic carbon pathway Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008465 hydroxypyruvate reductase (NADH) activity Molecular Function

GO:0008720 D-lactate dehydrogenase (NAD+) activity Molecular Function

GO:0016618 hydroxypyruvate reductase [NAD(P)H] activity Molecular Function

GO:0030267 glyoxylate reductase (NADPH) activity Molecular Function

GO:0047964 glyoxylate reductase (NADH) activity Molecular Function

GO:0047995 (2R)-hydroxyphenylpyruvate reductase [NAD(P)H] activity Molecular Function

KEGG gene cross-reference

ag:CAD47810

ath:AT1G12550

ath:AT1G79870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.970

Rank 1 · TkA01G483580 · TK1151

Cytoplasm0.095

Rank 2 · TkA01G483580 · TK1151

Cell membrane0.024

Rank 3 · TkA01G483580 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA01G483580 · TK1151

Plastid0.016

Rank 5 · TkA01G483580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP282-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483580	`PF00847`	AP2	82	132	2.5e-16	60.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKG1`	Arabidopsis thaliana	sp\|Q9FKG1\|EF104_ARATH Ethylene-responsive transcription factor ERF104	42.300%	Swiss-Prot	Medium
`Q8VY90`	Arabidopsis thaliana	sp\|Q8VY90\|EF105_ARATH Ethylene-responsive transcription factor ERF105	41.300%	Swiss-Prot	Medium
`O80341`	Arabidopsis thaliana	sp\|O80341\|EF102_ARATH Ethylene-responsive transcription factor 5	55.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card