TkA01G483570 | RubberDandelionOmics

Gene overview

TkA01G483570

Reference: TK1151 Chr: Chr01 Coordinates: 121052238-121053003 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

445 bp · TkA01G483570|TK1151|cDNA

TGCTAAATCAATTGAATTCAAAAAAACACGTTTACCGACCCCAGTCACAGCCATGGCTAAAGAAATTCACTTCAATCATGATGGTTCAACAACAATCAAGCTCCTGGCAGGCGTGAACATTGTCGCAAAGCTGATTGGAGTTACTTTGGGTCCAAGAGGTAGGAACGTAGTGTTGCAGAACAAGTATGGTCCTCCCAAGATTGTTAACGATGGTGAAACCGTTCTCAAAGAGATTCAATTAGAGGACCCTCTTGAGAATG...

CDS

Download CDS FASTA

393 bp · TkA01G483570|TK1151|CDS

ATGGCTAAAGAAATTCACTTCAATCATGATGGTTCAACAACAATCAAGCTCCTGGCAGGCGTGAACATTGTCGCAAAGCTGATTGGAGTTACTTTGGGTCCAAGAGGTAGGAACGTAGTGTTGCAGAACAAGTATGGTCCTCCCAAGATTGTTAACGATGGTGAAACCGTTCTCAAAGAGATTCAATTAGAGGACCCTCTTGAGAATGTCGGGGTGAAATTAGTGAGACAAGCTGGTGCAAAAACAAACGATCTTGCCGG...

Protein

Download Protein FASTA

131 aa · TkA01G483570|TK1151|PROTEIN

MAKEIHFNHDGSTTIKLLAGVNIVAKLIGVTLGPRGRNVVLQNKYGPPKIVNDGETVLKEIQLEDPLENVGVKLVRQAGAKTNDLAGDGSTTSIILAHGLISEGVKVNAAGMNPIQISREIQRTSEYSILV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483570`
TK1151 ID	TkA01G483570
OH-1004 ID	LXL04_021441
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 96.183 / OH-1004 20.521 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483570

Location Chr01:121052238-121053003 (-)

Description Similar to CPN60B4: Chaperonin 60 subunit beta 4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26230`	Involved in protein assisted folding.	No verified direct reference in this release
`At1g55490`	Binds RuBisCO small and large subunits and is implicated in the assembly of the enzyme oligomer.	Deletion of a chaperonin 60 beta gene leads to cell death in the Arabidopsis lesion initiation 1 mutant.2003 · DOI: 10.1093/pcp/pcg031
`At3g13470`	Involved in protein assisted folding.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021441 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0009409 response to cold Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0042026 protein refolding Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

KEGG gene cross-reference

ath:AT1G26230

ath:AT1G55490

ath:AT3G13470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.498

Rank 1 · TkA01G483570 · TK1151

Mitochondrion0.154

Rank 2 · TkA01G483570 · TK1151

Nucleus0.135

Rank 3 · TkA01G483570 · TK1151

Peroxisome0.116

Rank 4 · TkA01G483570 · TK1151

Plastid0.115

Rank 5 · TkA01G483570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19417RnlA_toxin_N5-22 aa

PF00118Cpn60_TCP124-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483570	`PF19417`	RnlA_toxin_N	5	22	0.1	13.6
TkA01G483570	`PF00118`	Cpn60_TCP1	24	126	2.5e-26	93.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C667`	Arabidopsis thaliana	sp\|Q9C667\|CPNB4_ARATH Chaperonin 60 subunit beta 4, chloroplastic	79.100%	Swiss-Prot	High
`P21240`	Arabidopsis thaliana	sp\|P21240\|CPNB1_ARATH Chaperonin 60 subunit beta 1, chloroplastic	67.200%	Swiss-Prot	High
`Q9LJE4`	Arabidopsis thaliana	sp\|Q9LJE4\|CPNB2_ARATH Chaperonin 60 subunit beta 2, chloroplastic	67.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card