TkA01G483370 | RubberDandelionOmics

Gene overview

TkA01G483370

Reference: TK1151 Chr: Chr01 Coordinates: 121009690-121010094 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA01G483370|TK1151|cDNA

ATGTACGGAATCGCCGTCGCCGCCCTCGGAATGCTCAGCACCATCGCCACCGGCCTCGCCATTGACGCCTACGGCCCGATCTCCGACAACGCCAGCGGAATCGCCGAGATGTCCGGGATGAGCCACCGGATCCGTGAACGAACCGACGCACTAGGCGCCGCCGGAAACACCACCGCCGCGATTGGAAAAGGTTTTGCGATAGGATCTTCGGCGCTTGTCTCGTTGGCGCTGTTTGGTGCATTTGTGAGCCGTGCGGGGAT...

CDS

Download CDS FASTA

405 bp · TkA01G483370|TK1151|CDS

ATGTACGGAATCGCCGTCGCCGCCCTCGGAATGCTCAGCACCATCGCCACCGGCCTCGCCATTGACGCCTACGGCCCGATCTCCGACAACGCCAGCGGAATCGCCGAGATGTCCGGGATGAGCCACCGGATCCGTGAACGAACCGACGCACTAGGCGCCGCCGGAAACACCACCGCCGCGATTGGAAAAGGTTTTGCGATAGGATCTTCGGCGCTTGTCTCGTTGGCGCTGTTTGGTGCATTTGTGAGCCGTGCGGGGAT...

Protein

Download Protein FASTA

134 aa · TkA01G483370|TK1151|PROTEIN

MYGIAVAALGMLSTIATGLAIDAYGPISDNASGIAEMSGMSHRIRERTDALGAAGNTTAAIGKGFAIGSSALVSLALFGAFVSRAGIEVVDVLTPKVFIGLIVGAMLPYRFYAMTMKSVGSAALKMVEEVGCRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483370`
TK1151 ID	TkA01G483370
OH-1004 ID	LXL04_009179
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.400
Protein coverage (%)	TK1151 97.015 / OH-1004 16.993 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483370

Location Chr01:121009690-121010094 (-)

Description Similar to Pyrophosphate-energized vacuolar membrane proton pump

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15690`	May contribute to the H⁺ electrochemical gradient across the tonoplast from the cytosol to the vacuolar lumen.	Arabidopsis H+-PPase AVP1 regulates auxin-mediated organ development.2005 · DOI: 10.1126/science.1115711

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009179 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005985 sucrose metabolic process Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0010248 establishment or maintenance of transmembrane electrochemical gradient Biological Process

GO:0010581 regulation of starch biosynthetic process Biological Process

GO:0048366 leaf development Biological Process

GO:0052546 cell wall pectin metabolic process Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G15690

lic:LIC_12285

lil:LA_1471

vra:106768298

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.162

Rank 1 · TkA01G483370 · TK1151

Mitochondrion0.149

Rank 2 · TkA01G483370 · TK1151

Endoplasmic reticulum0.146

Rank 3 · TkA01G483370 · TK1151

Plastid0.108

Rank 4 · TkA01G483370 · TK1151

Lysosome / Vacuole0.094

Rank 5 · TkA01G483370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03030H_PPase1-130 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483370	`PF03030`	H_PPase	1	130	9.8e-54	183.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P31414`	Arabidopsis thaliana	sp\|P31414\|AVP1_ARATH Pyrophosphate-energized vacuolar membrane proton pump 1	91.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card