TkA01G483340 | RubberDandelionOmics

Gene overview

TkA01G483340

Reference: TK1151 Chr: Chr01 Coordinates: 121004982-121007562 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

864 bp · TkA01G483340|TK1151|cDNA

AAAAAAACGAAAAAGAAAGTGGCATAATCAACGGCCACCTAGGAAGACCTTCTTACGTGTTACGATCTTACTTGAGTGAACTTCTTTACAAACGTACGCGCGAAGCACCAGAGTACAAAATACCCAATCCCTAAATATCATCATCTTCTTCCACTCTTATCCAGTGAGCCATGTCTCTCCTCCAACTTCAACTCCCTCTCTCCCAATTCAAATCCCTCAATCTTTCCACTCCTTTCCTCCATGGCACCTCCGTCGTCTCC...

CDS

Download CDS FASTA

474 bp · TkA01G483340|TK1151|CDS

ATGTCTCTCCTCCAACTTCAACTCCCTCTCTCCCAATTCAAATCCCTCAATCTTTCCACTCCTTTCCTCCATGGCACCTCCGTCGTCTCCGCCAAACCCTCTTCCTCCACCACAATTCACCACCACCAGCAGCGCCACACGTATCTCCCTCCAATTCGCGCCATGAGATCTCTCCAAGGCCGCGTAATCTGCACCGCCAACGATAAGACCGTGAATGTTGAAGTGACTCGCCTCGCGCCTCACCCAAAGTACAAGCGCAG...

Protein

Download Protein FASTA

157 aa · TkA01G483340|TK1151|PROTEIN

MSLLQLQLPLSQFKSLNLSTPFLHGTSVVSAKPSSSTTIHHHQQRHTYLPPIRAMRSLQGRVICTANDKTVNVEVTRLAPHPKYKRRVRKKKKFQAHDPENQFQIGDLVQLEKCKPISKKKTFLAIPVPKRTAAKQPKESAPQDIGIPLESDSSSQV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G483340`
TK1151 ID	TkA01G483340
OH-1004 ID	LXL04_002103
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G483340

Location Chr01:121004982-121007562 (-)

Description Similar to RPS17: 30S ribosomal protein S17, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g79850`	One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q9ZST1`	One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002103 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0032544 plastid translation Biological Process

GO:0000312 plastid small ribosomal subunit Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT1G79850

dosa:Os04g0691600

zma:542469

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.892

Rank 1 · TkA01G483340 · TK1151

Mitochondrion0.078

Rank 2 · TkA01G483340 · TK1151

Nucleus0.039

Rank 3 · TkA01G483340 · TK1151

Cytoplasm0.010

Rank 4 · TkA01G483340 · TK1151

Cell membrane0.004

Rank 5 · TkA01G483340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23037KOWx_SPT525-34 aa

PF00366Ribosomal_S1728-42 aa

PF00366Ribosomal_S1760-123 aa

PF23037KOWx_SPT5102-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G483340	`PF23037`	KOWx_SPT5	25	34	0.25	11.7
TkA01G483340	`PF00366`	Ribosomal_S17	28	42	1.1e-24	87.0
TkA01G483340	`PF00366`	Ribosomal_S17	60	123	1.1e-24	87.0
TkA01G483340	`PF23037`	KOWx_SPT5	102	112	0.25	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P16180`	Arabidopsis thaliana	sp\|P16180\|RR17_ARATH Small ribosomal subunit protein uS17c	53.100%	Swiss-Prot	High
`Q9ZST1`	Oryza sativa subsp. japonica	sp\|Q9ZST1\|RR17_ORYSJ Small ribosomal subunit protein uS17c	65.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card