TkA01G482750 | RubberDandelionOmics

Gene overview

TkA01G482750

Reference: TK1151 Chr: Chr01 Coordinates: 120859777-120862030 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1521 bp · TkA01G482750|TK1151|cDNA

AAGTGATCAACTTGAAGACCACCGTTTACATGGATAAAACACGACGGTTCTGAAACTCTCAAGCTCCGTAGCCTTTTCCGACCTCCGCTACGGTGCCACCCCCCGCTGAAGCGACGCTACTGCCAACGGCAACGCTGTTGCTTGAGTCTTGAGTGAAACAATGGAAAGATTTCTGAAAAGGAAATCGCCTGGAAAATCTTCAACTGAAAATGCATCCAACGATATCTCTCCACCTCCAATGTTAACTGAAGCCGAATTGA...

CDS

Download CDS FASTA

1155 bp · TkA01G482750|TK1151|CDS

ATGGAAAGATTTCTGAAAAGGAAATCGCCTGGAAAATCTTCAACTGAAAATGCATCCAACGATATCTCTCCACCTCCAATGTTAACTGAAGCCGAATTGAATGATCTTCCATTAGACCCATCCGAGAGAAAAAGAATATCAGAATACCACCCAAATCAAATAGACGAAATAAGGCGAAAATATTTGATTAGAGGACCTTGCCAACCACGCGGCCACAAATTCCCTTGCAAAATAATAGGAAAAAAGAAAAGACGTTTCAA...

Protein

Download Protein FASTA

384 aa · TkA01G482750|TK1151|PROTEIN

MERFLKRKSPGKSSTENASNDISPPPMLTEAELNDLPLDPSERKRISEYHPNQIDEIRRKYLIRGPCQPRGHKFPCKIIGKKKRRFNPAWYNQYGDWLEYSVKADKAFCLYCYLFKDYVAKQGGGDAFVTEGFNGWNKTERLSSHVGNANSFHNRARGKCEEFMKQDQSIVVAIQNKNNFETDGYQIQLNHSSVNNNSALLVIDMQNDFVLEDGSLRVDGGLAIVPNVIKAVEVARQRGFLIVWVVREHDQMGRDVEVFR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G482750`
TK1151 ID	TkA01G482750
OH-1004 ID	LXL04_011141
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	53.200
Protein coverage (%)	TK1151 36.719 / OH-1004 6.256 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G482750

Location Chr01:120859777-120862030 (+)

Description Similar to PI4KG7: Phosphatidylinositol 4-kinase gamma 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16190`	Does not possess nicotinamidase activity in vitro.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011141 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0046777 protein autophosphorylation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0004430 1-phosphatidylinositol 4-kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043424 protein histidine kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G13640

ath:AT1G26270

ath:AT2G03890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · TkA01G482750 · TK1151

Nucleus0.415

Rank 2 · TkA01G482750 · TK1151

Mitochondrion0.081

Rank 3 · TkA01G482750 · TK1151

Cell membrane0.056

Rank 4 · TkA01G482750 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkA01G482750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14291DUF4371126-192 aa

PF00857Isochorismatase198-374 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G482750	`PF14291`	DUF4371	126	192	1.1e-16	61.8
TkA01G482750	`PF00857`	Isochorismatase	198	374	5.8e-38	131.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Z51`	Arabidopsis thaliana	sp\|Q93Z51\|NIC4_ARATH Probable inactive nicotinamidase At3g16190	69.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card