TkA01G478290 | RubberDandelionOmics

Gene overview

TkA01G478290

Reference: TK1151 Chr: Chr01 Coordinates: 119787245-119789205 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1175 bp · TkA01G478290|TK1151|cDNA

TCGGTAAATACTACGTACATGACTTTTCTAAGCATATTCAACGACGCAAGTTATTTTTGTGAATATTTTTAGTCAATCGACTAGCCAAAATCATAGAACCGGTTTTCTGGTTTCCTTTTCCTCGCTATTTTCGGTTGTTTTCTTCGTTTACACAAGCCCTAGCCCAGCAAGTGCGAGATTTGTCCTTGAATATGGATCAATTTGGGGTAGGAAACTGGAATATGATCCCAACCATGGCGACTCATAGCAACCCTACCACG...

CDS

Download CDS FASTA

531 bp · TkA01G478290|TK1151|CDS

ATGGATCAATTTGGGGTAGGAAACTGGAATATGATCCCAACCATGGCGACTCATAGCAACCCTACCACGCCATCCAGTCAGGATCATCTGTATCTCCAGCAACCGCAGCAATTTCAACAACAGCATCAGCAGCAGTTTCATCAACAACAACAATTTCAACTCCAACAACAGCAACAGCGGTATCAGATTTCTCAACAACAGCAGCATCAACAGCAACAGCAACAACCACAGCCTTCACAATCATTGGCCTCCCACTTTCA...

Protein

Download Protein FASTA

176 aa · TkA01G478290|TK1151|PROTEIN

MDQFGVGNWNMIPTMATHSNPTTPSSQDHLYLQQPQQFQQQHQQQFHQQQQFQLQQQQQRYQISQQQQHQQQQQQPQPSQSLASHFHLQNLVENLADAIENGTRDQHFDTLVTELSTHFEKCQQLLNTISGSIATKAATVEGQKRKVEEAEQMLNQRRELIAKYRNSVEELTKSDL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G478290`
TK1151 ID	TkA01G478290
OH-1004 ID	LXL04_030041
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 53.704 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G478290

Location Chr01:119787245-119789205 (+)

Description Similar to ALA3: Phospholipid-transporting ATPase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g55080`	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030041 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006893 Golgi to plasma membrane transport Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010286 heat acclimation Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:0048194 Golgi vesicle budding Biological Process

KEGG gene cross-reference

ath:AT1G54280

ath:AT1G59820

ath:AT1G72700

ath:AT3G13900

ath:AT3G27870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.802

Rank 1 · TkA01G478290 · TK1151

Cytoplasm0.359

Rank 2 · TkA01G478290 · TK1151

Mitochondrion0.022

Rank 3 · TkA01G478290 · TK1151

Cell membrane0.021

Rank 4 · TkA01G478290 · TK1151

Lysosome / Vacuole0.017

Rank 5 · TkA01G478290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05003DUF66811-63 aa

PF03153TFIIA17-148 aa

PF00175NAD_binding_124-76 aa

PF16789YscO-like49-67 aa

PF07544Med955-66 aa

PF22485DUF698758-103 aa

PF30398EF-hand_EFCB564-121 aa

PF05003DUF66897-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G478290	`PF05003`	DUF668	11	63	0.63	11.2
TkA01G478290	`PF03153`	TFIIA	17	148	0.0058	17.4
TkA01G478290	`PF00175`	NAD_binding_1	24	76	5.7	8.4
TkA01G478290	`PF16789`	YscO-like	49	67	0.0048	17.6
TkA01G478290	`PF07544`	Med9	55	66	5.2e-07	30.4
TkA01G478290	`PF22485`	DUF6987	58	103	0.74	10.3
TkA01G478290	`PF30398`	EF-hand_EFCB5	64	121	2.3	9.6
TkA01G478290	`PF05003`	DUF668	97	149	0.63	11.2
TkA01G478290	`PF07544`	Med9	98	168	5.2e-07	30.4
TkA01G478290	`PF22485`	DUF6987	110	170	0.74	10.3
TkA01G478290	`PF16789`	YscO-like	119	173	0.0048	17.6
TkA01G478290	`PF30398`	EF-hand_EFCB5	152	169	2.3	9.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWA2`	Arabidopsis thaliana	sp\|Q8RWA2\|MED9_ARATH Mediator of RNA polymerase II transcription subunit 9	68.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card