TkA01G477590 | RubberDandelionOmics

Gene overview

TkA01G477590

Reference: TK1151 Chr: Chr01 Coordinates: 119630930-119631505 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

576 bp · TkA01G477590|TK1151|cDNA

ATGTCTTACCAACCGAGATCTTCAAATCACAACGAAAGCGACGACGACCACCACCACAACCGTCGCTTATATAACCCTTACCAAGATCTTCGAGTCCCAGTACAAACTTTGTACAAACTCCCCACATCTCCCGAATACCTCTTTCAAGAGGAATCCGTCGCTCAACGCCGTTCATGGGGAGAAAACCTCACATACTACACCGGCATCGGTTACCTCGGCGGCGCTGTAGTTGGTGCCGGGAAAGGTTTAGTAGAGGGCGT...

CDS

Download CDS FASTA

576 bp · TkA01G477590|TK1151|CDS

ATGTCTTACCAACCGAGATCTTCAAATCACAACGAAAGCGACGACGACCACCACCACAACCGTCGCTTATATAACCCTTACCAAGATCTTCGAGTCCCAGTACAAACTTTGTACAAACTCCCCACATCTCCCGAATACCTCTTTCAAGAGGAATCCGTCGCTCAACGCCGTTCATGGGGAGAAAACCTCACATACTACACCGGCATCGGTTACCTCGGCGGCGCTGTAGTTGGTGCCGGGAAAGGTTTAGTAGAGGGCGT...

Protein

Download Protein FASTA

191 aa · TkA01G477590|TK1151|PROTEIN

MSYQPRSSNHNESDDDHHHNRRLYNPYQDLRVPVQTLYKLPTSPEYLFQEESVAQRRSWGENLTYYTGIGYLGGAVVGAGKGLVEGVKASEPGDTAKLRVNRILNASGHAGRKIGNRAGVIGLLYAGLESGMVAVRDADDIINSVVAGLGTGALYKAAAGPRSAAVAGAIGGIAVGLAVTGKQVLKRYVPI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G477590`
TK1151 ID	TkA01G477590
OH-1004 ID	LXL04_002168
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G477590

Location Chr01:119630930-119631505 (+)

Description Similar to TIM23-1: Mitochondrial import inner membrane translocase subunit TIM23-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72750`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release
`At1g17530`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release
`At3g04800`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002168 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0008320 protein transmembrane transporter activity Molecular Function

GO:0015450 protein-transporting ATPase activity Molecular Function

GO:0030943 mitochondrion targeting sequence binding Molecular Function

KEGG gene cross-reference

ath:AT1G17530

ath:AT1G72750

ath:AT3G04800

sce:YNR017W

spo:2538784

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.936

Rank 1 · TkA01G477590 · TK1151

Cytoplasm0.060

Rank 2 · TkA01G477590 · TK1151

Nucleus0.055

Rank 3 · TkA01G477590 · TK1151

Cell membrane0.026

Rank 4 · TkA01G477590 · TK1151

Plastid0.015

Rank 5 · TkA01G477590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466Tim1764-173 aa

PF30969DUF876774-80 aa

PF30969DUF8767134-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G477590	`PF02466`	Tim17	64	173	1e-29	103.8
TkA01G477590	`PF30969`	DUF8767	74	80	0.00056	20.7
TkA01G477590	`PF30969`	DUF8767	134	183	0.00056	20.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38820`	Arabidopsis thaliana	sp\|Q38820\|TI232_ARATH Mitochondrial import inner membrane translocase subunit TIM23-2	66.500%	Swiss-Prot	High
`Q9LNQ1`	Arabidopsis thaliana	sp\|Q9LNQ1\|TI231_ARATH Mitochondrial import inner membrane translocase subunit TIM23-1	66.900%	Swiss-Prot	High
`Q9S837`	Arabidopsis thaliana	sp\|Q9S837\|TI233_ARATH Mitochondrial import inner membrane translocase subunit TIM23-3	53.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card