TkA01G476160 | RubberDandelionOmics

Gene overview

TkA01G476160

Reference: TK1151 Chr: Chr01 Coordinates: 119259484-119262878 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1885 bp · TkA01G476160|TK1151|cDNA

TGTTCGTTACCGATGAGTCATACACCAACTCAAAACCCTCTAAAATACTCACCCGCTGCCATGGCATCCTCACCAGATCATCGAGCCGTTTTGTCGTATAACAGTCTTCTCTGGACTCCATAACGTCTGCTGTTTCTCCCCCCAAATTAGCTCGAAAAGCATTGCAGATATGGGTTTTGCTAAGGAGTACGAGTTCTTAACGGAGATTGGTATCGAGCCTAAAAATTCCGGTAGCTTTGTTAATGGTGCTTGGAAGGGGA...

CDS

Download CDS FASTA

1200 bp · TkA01G476160|TK1151|CDS

ATGTGCGACTTTGCTGTGGGTTTAAGCCGACAATTAAACGGATCCGTCATACCTTCTGAACGTCCAAATCATATGATGCTCGAGATGTGGAATCCTCTTGGAGTAGTTGGTGTCATTACAGCATTCAATTTTCCTTGTGCTGTTCTTGGATGGAATGCATGCATTGCTCTAGTCTGTGGAAACTGTGTTGTTTGGAAAGGTGCTCCAACCACACCTTTAATCACAATAGCAATGACAAAACTAATTGCAGAAGTTCTAGA...

Protein

Download Protein FASTA

399 aa · TkA01G476160|TK1151|PROTEIN

MCDFAVGLSRQLNGSVIPSERPNHMMLEMWNPLGVVGVITAFNFPCAVLGWNACIALVCGNCVVWKGAPTTPLITIAMTKLIAEVLEKNNLPPAIFTSFCGGAEIGQAIAKDTRIPLVSFTGSSKVGLMVQQTVSQRFGKCLLELSGNNALIVMDDADIQLAVRSVLFAAVGTAGQRCTTCRRLLVHEKVYDTVVDKLLEAYKQVKVGDPLETGTLLGPLHTKASRENFEKGIKVIKSQGGKILTGGSVIESEGNFVQPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G476160`
TK1151 ID	TkA01G476160
OH-1004 ID	LXL04_002183
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	97.700
Protein coverage (%)	TK1151 96.742 / OH-1004 71.218 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G476160

Location Chr01:119259484-119262878 (+)

Description Similar to ALDH7B4: Aldehyde dehydrogenase family 7 member B4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54100`	Aldehyde dehydrogenase family 7 member B4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002183 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006081 aldehyde metabolic process Biological Process

GO:0006554 lysine catabolic process Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042997 negative regulation of Golgi to plasma membrane protein transport Biological Process

GO:0097009 energy homeostasis Biological Process

GO:0110076 negative regulation of ferroptosis Biological Process

GO:1905750 negative regulation of endosome to plasma membrane protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G54100

dre:334197

mdm:103400922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.536

Rank 1 · TkA01G476160 · TK1151

Peroxisome0.240

Rank 2 · TkA01G476160 · TK1151

Mitochondrion0.181

Rank 3 · TkA01G476160 · TK1151

Nucleus0.166

Rank 4 · TkA01G476160 · TK1151

Cell membrane0.065

Rank 5 · TkA01G476160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171Aldedh2-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G476160	`PF00171`	Aldedh	2	365	1.2e-109	367.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYG7`	Arabidopsis thaliana	sp\|Q9SYG7\|AL7B4_ARATH Aldehyde dehydrogenase family 7 member B4	84.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card