TkA01G474800 | RubberDandelionOmics

Gene overview

TkA01G474800

Reference: TK1151 Chr: Chr01 Coordinates: 118841281-118842142 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

696 bp · TkA01G474800|TK1151|cDNA

TAGGCTACGCGGAGTGGTGCCATAGCAAGGTCGCTATGGCGACAGCGAGACCAGCTACACCACTCCCCAACCATTCGCTGAAGGCTCGCTAAGGGATGCCTCGCTATACTGTGGGCGAGCTTATAGCGAGAGACGACAAGGATCGCGATCCGTTGCTGGTTCCATTTGCAAGGTAGCTGTTAATTTGGCTAATACGTTATCACAACAAGTCGAAGGAGAAGGGAGCAATGCTATTCGAAGATTTAGACGATATATCAAAA...

CDS

Download CDS FASTA

336 bp · TkA01G474800|TK1151|CDS

ATGCATAAACCTTTGTTTTTTCGTATTGTGGAAGGTGTGTGCTCAGTGTGTGACAGTTTTACTCAACGTCCAGATGCACGAGGTACATTAGGCTTTACTCCGATTCAAAAATGTTCTGCTGCACTTCGTATGTTAGCTTATGGCACCCACCCCGATTCACTAGATGAGAATTTTAGGATGGCTGAGCGTACTGCACGAGATACTCTTATACATTTTTGTGACAGCATTTTGCAATTGTACGCCCCACGATATTTGCGTTA...

Protein

Download Protein FASTA

112 aa · TkA01G474800|TK1151|PROTEIN

MHKPLFFRIVEGVCSVCDSFTQRPDARGTLGFTPIQKCSAALRMLAYGTHPDSLDENFRMAERTARDTLIHFCDSILQLYAPRYLRYPTPNDVKQLYDHHANVHGFPGMLGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G474800`
TK1151 ID	TkA01G474800
OH-1004 ID	LXL04_000992
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.200
Protein coverage (%)	TK1151 93.750 / OH-1004 13.208 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G474800`
Location	Chr01:118841281-118842142 (-)
Description	Similar to GBP7: Guanylate-binding protein 7
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_000992` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001818 negative regulation of cytokine production Biological Process GO:0002218 activation of innate immune response Biological Process GO:0006605 protein targeting Biological Process GO:0009617 response to bacterium Biological Process GO:0032480 negative regulation of type I interferon production Biological Process GO:0032731 positive regulation of interleukin-1 beta production Biological Process GO:0032741 positive regulation of interleukin-18 production Biological Process GO:0034067 protein localization to Golgi apparatus Biological Process GO:0034345 negative regulation of type III interferon production Biological Process GO:0035458 cellular response to interferon-beta Biological Process GO:0042742 defense response to bacterium Biological Process GO:0042832 defense response to protozoan Biological Process
KEGG gene cross-reference	hsa:115361 hsa:115362 hsa:388646 mmu:229900 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.895

Rank 1 · TkA01G474800 · TK1151

Cytoplasm0.200

Rank 2 · TkA01G474800 · TK1151

Mitochondrion0.017

Rank 3 · TkA01G474800 · TK1151

Extracellular0.016

Rank 4 · TkA01G474800 · TK1151

Cell membrane0.015

Rank 5 · TkA01G474800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28509DUF84181-13 aa

PF28509DUF841858-60 aa

PF04827Plant_tran83-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G474800	`PF28509`	DUF8418	1	13	0.14	12.6
TkA01G474800	`PF28509`	DUF8418	58	60	0.14	12.6
TkA01G474800	`PF04827`	Plant_tran	83	112	0.23	11.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card