TkA01G474660 | RubberDandelionOmics

Gene overview

TkA01G474660

Reference: TK1151 Chr: Chr01 Coordinates: 118817708-118818468 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

699 bp · TkA01G474660|TK1151|cDNA

ATGGAGAAGGATAATCTTGAAGGTTCGGTGGGTTTAACCATATGTAGTATCGGAAAACCAGAAGCTATTCCTGGCCAGCAAGGATTTGGAGCAGGTCAAGCGTCGTTAATGGCAAAACAGAAGGCTGCTGCAGGTGGTGGTGGTGGTGGTGGTGTCGATCTAATGTTGCTTAACAACACCAAAGGAGTTTTCCGGTTGGCAGATGTGATGAAGGCCGCCGCAGAGGTGCTCGGAAATGGCATGCTGGGGTCATCGTACAA...

CDS

Download CDS FASTA

699 bp · TkA01G474660|TK1151|CDS

ATGGAGAAGGATAATCTTGAAGGTTCGGTGGGTTTAACCATATGTAGTATCGGAAAACCAGAAGCTATTCCTGGCCAGCAAGGATTTGGAGCAGGTCAAGCGTCGTTAATGGCAAAACAGAAGGCTGCTGCAGGTGGTGGTGGTGGTGGTGGTGTCGATCTAATGTTGCTTAACAACACCAAAGGAGTTTTCCGGTTGGCAGATGTGATGAAGGCCGCCGCAGAGGTGCTCGGAAATGGCATGCTGGGGTCATCGTACAA...

Protein

Download Protein FASTA

232 aa · TkA01G474660|TK1151|PROTEIN

MEKDNLEGSVGLTICSIGKPEAIPGQQGFGAGQASLMAKQKAAAGGGGGGGVDLMLLNNTKGVFRLADVMKAAAEVLGNGMLGSSYKATMTNGMTVVVKRVKDMTLIDKNGFEAEMMKLGRLSHPNVLAPLACLYRKQEKLLIYEYIPTGSLLYLLHGDRGKRHTELSWGSRLKIIQGIAQGLGYIQNELATLELPHGNLKSSNVLIALVTSRYSWISVCNTWSINTTSQMR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G474660`
TK1151 ID	TkA01G474660
OH-1004 ID	LXL04_002204
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 89.224 / OH-1004 29.812 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G474660

Location Chr01:118817708-118818468 (+)

Description Similar to PRK3: Pollen receptor-like kinase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42880`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	No verified direct reference in this release
`At5g20690`	Key receptor for sensing species-specific attractants in cooperation with other pollen receptor-like kinases.	Tip-localized receptors control pollen tube growth and LURE sensing in Arabidopsis.2016 · DOI: 10.1038/nature17413 Structural basis for receptor recognition of pollen tube attraction peptides.2017 · DOI: 10.1038/s41467-017-01323-8
`At3g20190`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	No verified direct reference in this release
`At4g31250`	Probable LRR receptor-like serine/threonine-protein kinase At4g31250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002204 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010183 pollen tube guidance Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT3G20190

ath:AT3G42880

ath:AT4G31250

ath:AT5G20690

ath:AT5G35390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.719

Rank 1 · TkA01G474660 · TK1151

Cytoplasm0.220

Rank 2 · TkA01G474660 · TK1151

Nucleus0.196

Rank 3 · TkA01G474660 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA01G474660 · TK1151

Golgi apparatus0.026

Rank 5 · TkA01G474660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr74-208 aa

PF00069Pkinase75-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G474660	`PF07714`	PK_Tyr_Ser-Thr	74	208	9.5e-16	58.6
TkA01G474660	`PF00069`	Pkinase	75	208	5.3e-12	46.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1L7`	Arabidopsis thaliana	sp\|Q9M1L7\|PRK3_ARATH Pollen receptor-like kinase 3	59.000%	Swiss-Prot	Medium
`Q3E991`	Arabidopsis thaliana	sp\|Q3E991\|PRK6_ARATH Pollen receptor-like kinase 6	58.300%	Swiss-Prot	Medium
`Q9LJY0`	Arabidopsis thaliana	sp\|Q9LJY0\|PRK4_ARATH Pollen receptor-like kinase 4	49.400%	Swiss-Prot	Medium
`C0LGR9`	Arabidopsis thaliana	sp\|C0LGR9\|Y4312_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g31250	49.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card