TkA01G474300 | RubberDandelionOmics

Gene overview

TkA01G474300

Reference: TK1151 Chr: Chr01 Coordinates: 118702933-118704751 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1332 bp · TkA01G474300|TK1151|cDNA

CGAAAATATGGGTTGCACACTTGCAGTTGCCTTTTCCTTTACTTTTAATAAATCTGTTAACATTGTTACCGATTTTGACGATCCTAACCGAAAAGTTTCGGATTTAGATCCACCTCTTTCACATGATCCACTTTTCTTAAAAAATATCTACATCCACCGGCCCCATTTCAACACACAAACTCATCATTATTACAATATTCCTGTTTCTGGAGACTTCTTGCGGCCTTAATCGTCGAATGTATGGCATCCCCAACCTCTTC...

CDS

Download CDS FASTA

537 bp · TkA01G474300|TK1151|CDS

ATGGATGGTAACGGAGAAAAAAACATCGATTTTTATGAAGTTTTGGGGTTGAAGAAGGAATGCACGTTAGCGGAGCTCAAGAATGCCTACAAGAAGCTAGCAATGAGATGGCACCCTGATCGCTGTTCGGCCTCCGGTAATTCGAAGTACGTTGAAGAAGCGAAAAAGAAGTTTCAGGCAATCCAAGAAGCCTATTCTGTACTTTCCGACGAGAACAAAAGATTTTTGTACGACGTCGGAATTAATGACAGCGACGATGA...

Protein

Download Protein FASTA

178 aa · TkA01G474300|TK1151|PROTEIN

MDGNGEKNIDFYEVLGLKKECTLAELKNAYKKLAMRWHPDRCSASGNSKYVEEAKKKFQAIQEAYSVLSDENKRFLYDVGINDSDDDTDGMADFLNEMATMMNQNKPNVETSFEELKDLFKEMFESDIESSFGLSSETKSFAAINKRGSSEMSKSMVDDGWCFKTDDDHGRYKERRKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G474300`
TK1151 ID	TkA01G474300
OH-1004 ID	LXL04_032275
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	63.800
Protein coverage (%)	TK1151 99.438 / OH-1004 92.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G474300`
Location	Chr01:118702933-118704751 (+)
Description	Similar to dnaJ: Chaperone protein DnaJ (Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032275` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006260 DNA replication Biological Process GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0032880 regulation of protein localization Biological Process GO:0042026 protein refolding Biological Process GO:0045109 intermediate filament organization Biological Process GO:0090084 negative regulation of inclusion body assembly Biological Process GO:1900034 regulation of cellular response to heat Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	hsa:10049 hsm:HSM_0367 hso:HS_1195 tna:CTN_1726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · TkA01G474300 · TK1151

Nucleus0.512

Rank 2 · TkA01G474300 · TK1151

Endoplasmic reticulum0.052

Rank 3 · TkA01G474300 · TK1151

Cell membrane0.050

Rank 4 · TkA01G474300 · TK1151

Mitochondrion0.048

Rank 5 · TkA01G474300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12725DUF38109-73 aa

PF00226DnaJ10-78 aa

PF30912TIM141_C14-58 aa

PF08664YcbB22-42 aa

PF31247HAUS823-122 aa

PF04546Sigma70_ner45-69 aa

PF25101Spectrin_746-106 aa

PF12725DUF381078-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G474300	`PF12725`	DUF3810	9	73	0.037	14.2
TkA01G474300	`PF00226`	DnaJ	10	78	7.3e-22	78.0
TkA01G474300	`PF30912`	TIM141_C	14	58	0.0065	17.2
TkA01G474300	`PF08664`	YcbB	22	42	0.0099	16.7
TkA01G474300	`PF31247`	HAUS8	23	122	0.04	14.4
TkA01G474300	`PF04546`	Sigma70_ner	45	69	0.017	15.8
TkA01G474300	`PF25101`	Spectrin_7	46	106	0.13	13.3
TkA01G474300	`PF12725`	DUF3810	78	123	0.037	14.2
TkA01G474300	`PF26154`	DUF8042	82	123	0.35	11.9
TkA01G474300	`PF04546`	Sigma70_ner	83	147	0.017	15.8
TkA01G474300	`PF08664`	YcbB	88	147	0.0099	16.7
TkA01G474300	`PF00226`	DnaJ	103	119	7.3e-22	78.0
TkA01G474300	`PF25101`	Spectrin_7	109	127	0.13	13.3
TkA01G474300	`PF28203`	CDI_Immunity_Comp	121	156	0.5	11.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card