TkA01G470040 | RubberDandelionOmics

Gene overview

TkA01G470040

Reference: TK1151 Chr: Chr01 Coordinates: 117645304-117646883 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1026 bp · TkA01G470040|TK1151|cDNA

ATGTCTATTTACAAAATAATCGCTGAAATTAGACCAAGAGTTTATCGAAACTCGTACCTTTTAGATGATGAAGCTAACCCCCGAACACTACAGCCTACACACAGCTGTTATGAGGAATCCTGGCAGTCTAGGGATATCTCCAGCGGTGCTCCTCCTTCTCGACTGCAACAGAAAACAAGGGACGTGGTCGTCGGTGCTTTGGGTCGTATGAGGGGACGAGGAAGAGAAGGATGGGACTGCAACTTCCTCCGGCAGTGGCT...

CDS

Download CDS FASTA

1026 bp · TkA01G470040|TK1151|CDS

ATGTCTATTTACAAAATAATCGCTGAAATTAGACCAAGAGTTTATCGAAACTCGTACCTTTTAGATGATGAAGCTAACCCCCGAACACTACAGCCTACACACAGCTGTTATGAGGAATCCTGGCAGTCTAGGGATATCTCCAGCGGTGCTCCTCCTTCTCGACTGCAACAGAAAACAAGGGACGTGGTCGTCGGTGCTTTGGGTCGTATGAGGGGACGAGGAAGAGAAGGATGGGACTGCAACTTCCTCCGGCAGTGGCT...

Protein

Download Protein FASTA

341 aa · TkA01G470040|TK1151|PROTEIN

MSIYKIIAEIRPRVYRNSYLLDDEANPRTLQPTHSCYEESWQSRDISSGAPPSRLQQKTRDVVVGALGRMRGRGREGWDCNFLRQWLLATKPTTKTPEGDCRLREGFRRTGWSEEDGDVPGGRRKLERRRKKKLRRSSDTQESTQYVEETQEEVVDSDDSHDEEDGRRTEKAVRKNWTNIEDEVLARAWCGHSGDARYGNDQNAKQFWKHVTKRFNKELGKCDKYRTFDQCNSKWNKMNREVQKFNGAYVNPPSRNLPMG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G470040`
TK1151 ID	TkA01G470040
OH-1004 ID	LXL04_005653
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.900
Protein coverage (%)	TK1151 51.026 / OH-1004 25.040 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G470040`
Location	Chr01:117645304-117646883 (+)
Description	Similar to At5g17010: D-xylose-proton symporter-like 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005653` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009624 response to nematode Biological Process GO:0009845 seed germination Biological Process GO:0009911 positive regulation of flower development Biological Process GO:0015755 fructose transmembrane transport Biological Process GO:1904659 D-glucose transmembrane transport Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005774 vacuolar membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009705 plant-type vacuole membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component
KEGG gene cross-reference	ath:AT3G03090 ath:AT5G17010 ath:AT5G59250 bsu:BSU06230 bsu:BSU35830 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · TkA01G470040 · TK1151

Cytoplasm0.107

Rank 2 · TkA01G470040 · TK1151

Cell membrane0.021

Rank 3 · TkA01G470040 · TK1151

Mitochondrion0.014

Rank 4 · TkA01G470040 · TK1151

Endoplasmic reticulum0.013

Rank 5 · TkA01G470040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15761IMUP90-128 aa

PF13837Myb_DNA-bind_4128-149 aa

PF13873Myb_DNA-bind_5167-182 aa

PF13837Myb_DNA-bind_4174-246 aa

PF26772GVIN1_C199-241 aa

PF13873Myb_DNA-bind_5205-243 aa

PF15761IMUP267-305 aa

PF13837Myb_DNA-bind_4282-321 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G470040	`PF15761`	IMUP	90	128	0.14	13.7
TkA01G470040	`PF13837`	Myb_DNA-bind_4	128	149	6.7e-06	27.1
TkA01G470040	`PF13873`	Myb_DNA-bind_5	167	182	0.0041	17.8
TkA01G470040	`PF13837`	Myb_DNA-bind_4	174	246	6.7e-06	27.1
TkA01G470040	`PF26772`	GVIN1_C	199	241	0.11	13.4
TkA01G470040	`PF13873`	Myb_DNA-bind_5	205	243	0.0041	17.8
TkA01G470040	`PF15761`	IMUP	267	305	0.14	13.7
TkA01G470040	`PF13837`	Myb_DNA-bind_4	282	321	6.7e-06	27.1
TkA01G470040	`PF13873`	Myb_DNA-bind_5	330	338	0.0041	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card