TkA01G467340 | RubberDandelionOmics

Gene overview

TkA01G467340

Reference: TK1151 Chr: Chr01 Coordinates: 117026187-117026576 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA01G467340|TK1151|cDNA

ATGCTGTTGACAGTGGACGAGAATCTGAAACCGTTATCGGTACCGGTTAGGGTCGGGCAGGCGGTTGATGTAGTCGGGCAGGCCGGGCGGCCCAAGACAATCACTGGGTTTCAGACGCATTCCACACCTGTTCTGTTGGCTGCAGGGGATAGGGCGGAACTTGCTACAGACAAGTATATTCCTCTGTCTCCTATTTTGGAAGGGTTTGTTATCCTCAAAGAAAACCCGATTACAGGGAAGAAGCCTAGCCAAGCCAAGCA...

CDS

Download CDS FASTA

390 bp · TkA01G467340|TK1151|CDS

ATGCTGTTGACAGTGGACGAGAATCTGAAACCGTTATCGGTACCGGTTAGGGTCGGGCAGGCGGTTGATGTAGTCGGGCAGGCCGGGCGGCCCAAGACAATCACTGGGTTTCAGACGCATTCCACACCTGTTCTGTTGGCTGCAGGGGATAGGGCGGAACTTGCTACAGACAAGTATATTCCTCTGTCTCCTATTTTGGAAGGGTTTGTTATCCTCAAAGAAAACCCGATTACAGGGAAGAAGCCTAGCCAAGCCAAGCA...

Protein

Download Protein FASTA

129 aa · TkA01G467340|TK1151|PROTEIN

MLLTVDENLKPLSVPVRVGQAVDVVGQAGRPKTITGFQTHSTPVLLAAGDRAELATDKYIPLSPILEGFVILKENPITGKKPSQAKQAIYACLFVFGDVAVILGWFCVVDDMDLSGNVSCSTFNFVLQY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G467340`
TK1151 ID	TkA01G467340
OH-1004 ID	LXL04_023946
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 58.915 / OH-1004 8.207 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G467340

Location Chr01:117026187-117026576 (-)

Description Similar to RPN1A: 26S proteasome non-ATPase regulatory subunit 2 homolog A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20580`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins (By similarity).	No verified direct reference in this release
`At4g28470`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023946 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0042176 regulation of protein catabolic process Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT2G20580

ath:AT4G28470

bta:539784

mmu:21762

rno:287984

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.266

Rank 1 · TkA01G467340 · TK1151

Cytoplasm0.239

Rank 2 · TkA01G467340 · TK1151

Mitochondrion0.208

Rank 3 · TkA01G467340 · TK1151

Nucleus0.164

Rank 4 · TkA01G467340 · TK1151

Endoplasmic reticulum0.103

Rank 5 · TkA01G467340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18051RPN1_C25-76 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G467340	`PF18051`	RPN1_C	25	76	4.3e-31	107.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIV2`	Arabidopsis thaliana	sp\|Q9SIV2\|PSD2A_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog A	96.100%	Swiss-Prot	Medium
`Q6XJG8`	Arabidopsis thaliana	sp\|Q6XJG8\|PSD2B_ARATH 26S proteasome non-ATPase regulatory subunit 2 homolog B	92.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card