TkA01G466770 | RubberDandelionOmics

Gene overview

TkA01G466770

Reference: TK1151 Chr: Chr01 Coordinates: 116912464-116916773 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1584 bp · TkA01G466770|TK1151|cDNA

CTTTTAAGTCGCGTGGTTAAGTAGTACTCCGGCTACCAAGGCCAAGAGTAGGTGAGTGACAAAGAGGATCAACTTAAATTTAGTCAATTATTGTCATTTTTCTCGATGATTTCATAATGGACATAATCCTCTGCGACGAGCTCCTCCAAGAAATCTTCCACCGCCTCCCTCCTTCGTCGTCCTCCGCCGTCTCCCTCGTCTCCAAACGCTGGCGCCATCTCCTCCACTATTCCCTCTCCTCCCTCACCCTCCGTCTCTCC...

CDS

Download CDS FASTA

1410 bp · TkA01G466770|TK1151|CDS

ATGGACATAATCCTCTGCGACGAGCTCCTCCAAGAAATCTTCCACCGCCTCCCTCCTTCGTCGTCCTCCGCCGTCTCCCTCGTCTCCAAACGCTGGCGCCATCTCCTCCACTATTCCCTCTCCTCCCTCACCCTCCGTCTCTCCCCCAACCACCCTTCTCTCCCTTCCCTCTCTTCCTTCCTTTCTCGCCATACCTACCTCTTCTCCCTCTCCCTTTCCTCCACCCCCTCCTCAGCAGCTGCTACCACCGCCTTCTCCGA...

Protein

Download Protein FASTA

469 aa · TkA01G466770|TK1151|PROTEIN

MDIILCDELLQEIFHRLPPSSSSAVSLVSKRWRHLLHYSLSSLTLRLSPNHPSLPSLSSFLSRHTYLFSLSLSSTPSSAAATTAFSDSLLISISSACPNLTHLHLSTGPVSLFPLLSLSTSCPNITSLSIILSRPLLSIRFLASFNSLKKLTLILVGNGSSDSISDHHTSSLTELQLETLCLSGIRAGDYELSWLWNKCSYKTLSKLVFENCEGVGDNYSFASFIKRLKNLHDVELKTSRSVIALILLKLAENRCNSLSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G466770`
TK1151 ID	TkA01G466770
OH-1004 ID	LXL04_009200
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	27.500
Protein coverage (%)	TK1151 38.593 / OH-1004 29.331 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G466770`
Location	Chr01:116912464-116916773 (+)
Description	Similar to FBL4: F-box/LRR-repeat protein 4
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009200` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006289 nucleotide-excision repair Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0010225 response to UV-C Biological Process GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0019005 SCF ubiquitin ligase complex Cellular Component
KEGG gene cross-reference	ath:AT4G15475 ath:AT5G01720 hsa:84961 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.880

Rank 1 · TkA01G466770 · TK1151

Cytoplasm0.143

Rank 2 · TkA01G466770 · TK1151

Cell membrane0.031

Rank 3 · TkA01G466770 · TK1151

Plastid0.024

Rank 4 · TkA01G466770 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA01G466770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box5-36 aa

PF12937F-box-like7-36 aa

PF25019LRR_R13L1-DRL2137-60 aa

PF12799LRR_443-62 aa

PF29594LRR_SKP246-129 aa

PF00646F-box61-74 aa

PF25019LRR_R13L1-DRL2161-153 aa

PF28505DUF1699_N86-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G466770	`PF00646`	F-box	5	36	1.1e-06	29.0
TkA01G466770	`PF12937`	F-box-like	7	36	1.2e-05	25.7
TkA01G466770	`PF25019`	LRR_R13L1-DRL21	37	60	0.073	13.7
TkA01G466770	`PF12799`	LRR_4	43	62	0.62	11.1
TkA01G466770	`PF29594`	LRR_SKP2	46	129	2e-06	28.0
TkA01G466770	`PF00646`	F-box	61	74	1.1e-06	29.0
TkA01G466770	`PF25019`	LRR_R13L1-DRL21	61	153	0.073	13.7
TkA01G466770	`PF28505`	DUF1699_N	86	106	0.43	11.0
TkA01G466770	`PF24048`	LRR_NXF1-5	93	169	0.32	11.3
TkA01G466770	`PF13516`	LRR_6	97	106	3.3e-06	27.4
TkA01G466770	`PF12799`	LRR_4	98	142	0.62	11.1
TkA01G466770	`PF29594`	LRR_SKP2	99	153	2e-06	28.0
TkA01G466770	`PF28505`	DUF1699_N	103	126	0.43	11.0
TkA01G466770	`PF00646`	F-box	113	124	1.1e-06	29.0
TkA01G466770	`PF13516`	LRR_6	122	129	3.3e-06	27.4
TkA01G466770	`PF12799`	LRR_4	130	164	0.62	11.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card