Gene Card
Gene overview
cDNA / CDS / Protein Sequences
634 bp · TkA01G465170|TK1151|cDNA
TTTGTAATTCTAAAACAATTTTGTATTTAACTCACTGAAGTTCTTTTTTCATTGAAGGGGACTGAAAGAACCGGGAATCAATAGTTTTGTGGACGAAGTGATTGTGAATAGAAAACAATGGTCTACAGGAATCCAAGAAAAGATGACACATTCACACATATTCATATGTGCTCATAGCAGTCGCGATAAAAGGTGTGGTTTTTGTGGGCCAACTTTAATCAAAAAATTTAAAGAAGAAGCCGAATCAAGAGGATTAAAGA...
492 bp · TkA01G465170|TK1151|CDS
ATGACACATTCACACATATTCATATGTGCTCATAGCAGTCGCGATAAAAGGTGTGGTTTTTGTGGGCCAACTTTAATCAAAAAATTTAAAGAAGAAGCCGAATCAAGAGGATTAAAGAACATCTCCGTGACTGCCTGTTCCCATGTTGGGGGTCACAAGTATGCTGGAAACCTTATAATTTATAGTCTTCAAAACAACAAAGTTTGTGGTCATTGGTATGGTTATGTTGCTCCAAATGACGTCGCTGAATTACTCGACAA...
Protein
Download Protein FASTA163 aa · TkA01G465170|TK1151|PROTEIN
MTHSHIFICAHSSRDKRCGFCGPTLIKKFKEEAESRGLKNISVTACSHVGGHKYAGNLIIYSLQNNKVCGHWYGYVAPNDVAELLDNHIGKGQIIERLWRGQMGVPSVKKVQKAVDLEQPLIPNGNNVVIEKNRDQIKDGGGCCQGGNSGFSCCRDEKEVKKR
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G465170 |
|---|---|
| TK1151 ID | TkA01G465170 |
| OH-1004 ID | LXL04_023918 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 85.200 |
| Protein coverage (%) | TK1151 99.387 / OH-1004 45.128Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G465170 |
|---|---|
| Location | Chr01:116559934-116560741 (-) |
| Description | Similar to AIM32: Altered inheritance of mitochondria protein 32 (Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0005758 mitochondrial intermembrane space Cellular Component GO:0005759 mitochondrial matrix Cellular Component |
| KEGG gene cross-reference | cgr:2890881 clu:CLUG_02049 dha:DEHA2E10956g lth:KLTH0C02882g pgu:PGUG_03650 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06999Suc_Fer-like3-101 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G465170 | PF06999 | Suc_Fer-like | 3 | 101 | 1.1e-33 | 117.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.