TkA01G464090 | RubberDandelionOmics

Gene overview

TkA01G464090

Reference: TK1151 Chr: Chr01 Coordinates: 116272378-116273095 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA01G464090|TK1151|cDNA

ATGGGTGAGGTGGAAGCAGCCATACAGGAGATGTTTCAGGCGCCTCATATCCAGGTAATGAGGAGTTGTTCTAAACTGAGTAAGGTGTTCTTAGCTGCAATGGTGCATGAGTTTTATAAAACAGGAATGAGTGAGACCACCTTTGAAAATCTGGCGCAAATCGTTTCGAGTCTCTGTACAAGCAACGAAATCACATTTCCTGGATGGGACACACTACTGAGAATTGGGTGTAAGCTTGGTGAATCCAGAATCATTCTGTG...

CDS

Download CDS FASTA

375 bp · TkA01G464090|TK1151|CDS

ATGGGTGAGGTGGAAGCAGCCATACAGGAGATGTTTCAGGCGCCTCATATCCAGGTAATGAGGAGTTGTTCTAAACTGAGTAAGGTGTTCTTAGCTGCAATGGTGCATGAGTTTTATAAAACAGGAATGAGTGAGACCACCTTTGAAAATCTGGCGCAAATCGTTTCGAGTCTCTGTACAAGCAACGAAATCACATTTCCTGGATGGGACACACTACTGAGAATTGGGTGTAAGCTTGGTGAATCCAGAATCATTCTGTG...

Protein

Download Protein FASTA

124 aa · TkA01G464090|TK1151|PROTEIN

MGEVEAAIQEMFQAPHIQVMRSCSKLSKVFLAAMVHEFYKTGMSETTFENLAQIVSSLCTSNEITFPGWDTLLRIGCKLGESRIILCESGASHRFQKLQLNFPSDDVSFALKVSKELPWLTKYM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G464090`
TK1151 ID	TkA01G464090
OH-1004 ID	LXL04_035420
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.600
Protein coverage (%)	TK1151 100.000 / OH-1004 23.892 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G464090

Location Chr01:116272378-116273095 (+)

Description Similar to ORC1: Origin of replication complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g12620`	Essential protein required for ovules fertilization.	No verified direct reference in this release
`At4g14700`	Essential protein.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0187000`	Essential protein (By similarity).	Molecular cloning and characterization of a plant homologue of the origin recognition complex 1 (ORC1).2000 · DOI: 10.1016/s0168-9452(00)00297-1

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035420 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006260 DNA replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009744 response to sucrose Biological Process

GO:0033314 mitotic DNA replication checkpoint signaling Biological Process

GO:0000808 origin recognition complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005664 nuclear origin of replication recognition complex Cellular Component

GO:0003682 chromatin binding Molecular Function

GO:0003688 DNA replication origin binding Molecular Function

KEGG gene cross-reference

ath:AT4G12620

ath:AT4G14700

dosa:Os06g0187000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.639

Rank 1 · TkA01G464090 · TK1151

Cytoplasm0.392

Rank 2 · TkA01G464090 · TK1151

Mitochondrion0.076

Rank 3 · TkA01G464090 · TK1151

Cell membrane0.030

Rank 4 · TkA01G464090 · TK1151

Endoplasmic reticulum0.023

Rank 5 · TkA01G464090 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21312WHD_ORC117-62 aa

PF24103NT_N17-67 aa

PF09079WHD_Cdc618-110 aa

PF28262MPN33726-61 aa

PF11588DUF324328-57 aa

PF21312WHD_ORC164-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G464090	`PF21312`	WHD_ORC1	17	62	1.5e-08	35.7
TkA01G464090	`PF24103`	NT_N	17	67	0.26	12.3
TkA01G464090	`PF09079`	WHD_Cdc6	18	110	1.1e-09	38.9
TkA01G464090	`PF28262`	MPN337	26	61	0.15	11.2
TkA01G464090	`PF11588`	DUF3243	28	57	0.28	12.2
TkA01G464090	`PF21312`	WHD_ORC1	64	112	1.5e-08	35.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU24`	Arabidopsis thaliana	sp\|Q9SU24\|ORC1B_ARATH Origin of replication complex subunit 1B	72.600%	Swiss-Prot	High
`Q710E8`	Arabidopsis thaliana	sp\|Q710E8\|ORC1A_ARATH Origin of replication complex subunit 1A	69.400%	Swiss-Prot	High
`Q5SMU7`	Oryza sativa subsp. japonica	sp\|Q5SMU7\|ORC1_ORYSJ Origin of replication complex subunit 1	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card