TkA01G463810 | RubberDandelionOmics

Gene overview

TkA01G463810

Reference: TK1151 Chr: Chr01 Coordinates: 116203616-116204366 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

567 bp · TkA01G463810|TK1151|cDNA

ATGTTTGCTACAAAAAATCTTCAAAAGCGCTGCTTTCAAACTATCGCCTCCTGTTTCATTACCGATTTCTCCAGGGATGTGAAGTTGTTAAGAGGTGTGTGTATCCCCTATAATACACCACGGTATGCAATCCATTCCAGTTTTATGATTAGAGACGAGACATTTTATTGCTTTGGTGGATATCAGATGTTTTCTACTTCTAAAGGTCGGACCATGAGGAGTAAAGTGGAGATGCGAATGAAGAAAGAGTTTGGCAAAAC...

CDS

Download CDS FASTA

567 bp · TkA01G463810|TK1151|CDS

ATGTTTGCTACAAAAAATCTTCAAAAGCGCTGCTTTCAAACTATCGCCTCCTGTTTCATTACCGATTTCTCCAGGGATGTGAAGTTGTTAAGAGGTGTGTGTATCCCCTATAATACACCACGGTATGCAATCCATTCCAGTTTTATGATTAGAGACGAGACATTTTATTGCTTTGGTGGATATCAGATGTTTTCTACTTCTAAAGGTCGGACCATGAGGAGTAAAGTGGAGATGCGAATGAAGAAAGAGTTTGGCAAAAC...

Protein

Download Protein FASTA

188 aa · TkA01G463810|TK1151|PROTEIN

MFATKNLQKRCFQTIASCFITDFSRDVKLLRGVCIPYNTPRYAIHSSFMIRDETFYCFGGYQMFSTSKGRTMRSKVEMRMKKEFGKTLREIRQAKKINKKLMTDEEHLIYNLKIAKKKVALLLQKLKKYELPEMPPPRHDPELLTPEQVQALKKIGFRNRNYVPVGFRGVFGGVVQNMHMHWKFHETV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G463810`
TK1151 ID	TkA01G463810
OH-1004 ID	LXL04_000772
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	46.800
Protein coverage (%)	TK1151 50.000 / OH-1004 21.124 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G463810

Location Chr01:116203616-116204366 (-)

Description Similar to At3g25440: Uncharacterized CRM domain-containing protein At3g25440, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27550`	Involved in the splicing of group II introns in mitochondria.	CFM9, a Mitochondrial CRM Protein, Is Crucial for Mitochondrial Intron Splicing, Mitochondria Function and Arabidopsis Growth and Stress Responses.2019 · DOI: 10.1093/pcp/pcz147
`At3g25440`	Uncharacterized CRM domain-containing protein At3g25440, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0360100`	Required for the splicing of group IIA introns in chloroplasts, by regulating the intron folding.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000772 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000373 Group II intron splicing Biological Process

GO:0006397 mRNA processing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0048316 seed development Biological Process

GO:0140040 mitochondrial polycistronic RNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G23070

ath:AT3G25440

ath:AT3G27550

dosa:Os11g0592400

zma:100126360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.924

Rank 1 · TkA01G463810 · TK1151

Nucleus0.040

Rank 2 · TkA01G463810 · TK1151

Cytoplasm0.027

Rank 3 · TkA01G463810 · TK1151

Cell membrane0.007

Rank 4 · TkA01G463810 · TK1151

Plastid0.007

Rank 5 · TkA01G463810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06026Rib_5-P_isom_A73-128 aa

PF10226CCDC8581-108 aa

PF10226CCDC85112-130 aa

PF01985CRS1_YhbY144-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G463810	`PF06026`	Rib_5-P_isom_A	73	128	0.12	12.6
TkA01G463810	`PF10226`	CCDC85	81	108	0.2	12.0
TkA01G463810	`PF10226`	CCDC85	112	130	0.2	12.0
TkA01G463810	`PF01985`	CRS1_YhbY	144	188	1.1e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LT57`	Arabidopsis thaliana	sp\|Q9LT57\|CFM9_ARATH CRM-domain containing factor CFM9, mitochondrial	83.900%	Swiss-Prot	Medium
`Q67XL4`	Arabidopsis thaliana	sp\|Q67XL4\|Y3544_ARATH Uncharacterized CRM domain-containing protein At3g25440, chloroplastic	39.800%	Swiss-Prot	Medium
`Q6YYA3`	Oryza sativa subsp. japonica	sp\|Q6YYA3\|CRS1_ORYSJ Chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic	46.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card