TkA01G461410 | RubberDandelionOmics

Gene overview

TkA01G461410

Reference: TK1151 Chr: Chr01 Coordinates: 115623952-115625396 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1204 bp · TkA01G461410|TK1151|cDNA

AAAAGGACTATCGACTTTATTAATCAACTCCCAAAGTGGTTGCCCACCCTTTTCCTACTCCGATCGGAAAACCCCATAAACCCTACTAAAAAATCCCCTCGTAGTCTCTTTTACTACATCAACGCCGAGATGGGTACCCCGGAAACCTCGAGAGAACCGTGCCCGGACCGGATCTTGGACGACATCGGTGGCGCCTTTGGCATGGGAGCCGTTGGCGGCTCCGCTTTTCACTTTCTTAAAGGAATCTACAACTCACCAAA...

CDS

Download CDS FASTA

783 bp · TkA01G461410|TK1151|CDS

AAAAGGACTATCGACTTTATTAATCAACTCCCAAAGTGGTTGCCCACCCTTTTCCTACTCCGATCGGAAAACCCCATAAACCCTACTAAAAAATCCCCTCGTAGTCTCTTTTACTACATCAACGCCGAGATGGGTACCCCGGAAACCTCGAGAGAACCGTGCCCGGACCGGATCTTGGACGACATCGGTGGCGCCTTTGGCATGGGAGCCGTTGGCGGCTCCGCTTTTCACTTTCTTAAAGGAATCTACAACTCACCAAA...

Protein

Download Protein FASTA

260 aa · TkA01G461410|TK1151|PROTEIN

KRTIDFINQLPKWLPTLFLLRSENPINPTKKSPRSLFYYINAEMGTPETSREPCPDRILDDIGGAFGMGAVGGSAFHFLKGIYNSPKGERFIGGTQAVRMNAPRVGGSFAVWGGLFSTFDCTMVYVRQKEDPWNSIIAGAATGGFLQMRQGLGPATRSAVFGGVLLALIEGAGIMLNKFLSAQQPPPIMIEEAPQPPNNMPLGLQLPNQSPQFDSPPAASSSPSWFGGLFGGKQEEPTPKVKTEVLESFDSPAPPSFEFK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G461410`
TK1151 ID	TkA01G461410
OH-1004 ID	LXL04_002493
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	97.500
Protein coverage (%)	TK1151 75.769 / OH-1004 86.784 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G461410

Location Chr01:115623952-115625396 (-)

Description Similar to TIM17-2: Mitochondrial import inner membrane translocase subunit TIM17-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g37410`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	Identification, expression, and import of components 17 and 23 of the inner mitochondrial membrane translocase from Arabidopsis.2003 · DOI: 10.1104/pp.102.016808 The C-terminal region of TIM17 links the outer and inner mitochondrial membranes in Arabidopsis and is essential for protein import.2005 · DOI: 10.1074/jbc.m413299200
`At1g20350`	Essential component of the TIM17:23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002493 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0010954 positive regulation of protein processing Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0045039 protein insertion into mitochondrial inner membrane Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005744 TIM23 mitochondrial import inner membrane translocase complex Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0008320 protein transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G20350

ath:AT2G37410

hsa:10440

mmu:21854

rno:54311

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.859

Rank 1 · TkA01G461410 · TK1151

Plastid0.087

Rank 2 · TkA01G461410 · TK1151

Cytoplasm0.071

Rank 3 · TkA01G461410 · TK1151

Nucleus0.051

Rank 4 · TkA01G461410 · TK1151

Cell membrane0.021

Rank 5 · TkA01G461410 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02466Tim1758-165 aa

PF30969DUF8767125-171 aa

PF03988DUF347137-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G461410	`PF02466`	Tim17	58	165	6.9e-32	110.8
TkA01G461410	`PF30969`	DUF8767	125	171	0.061	14.1
TkA01G461410	`PF03988`	DUF347	137	168	0.095	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SP35`	Arabidopsis thaliana	sp\|Q9SP35\|TI172_ARATH Mitochondrial import inner membrane translocase subunit TIM17-2	62.600%	Swiss-Prot	High
`Q9LN27`	Arabidopsis thaliana	sp\|Q9LN27\|TI171_ARATH Mitochondrial import inner membrane translocase subunit TIM17-1	60.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card