TkA01G458950 | RubberDandelionOmics

Gene overview

TkA01G458950

Reference: TK1151 Chr: Chr01 Coordinates: 114929873-114931154 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

851 bp · TkA01G458950|TK1151|cDNA

CCGGAACCCAAAAGTTTTTCATATATGGTTAAATAACTCCGTTTAAATCCGCTCCACTCTACTCCTTAAATTCATCAGCCATCCGATCACCGTTTAATAAAAATCTGATCACCGTTTAATCAAATCATTCTTGTTGAAATGGCTCCGATCGCTGTTGGTGACAAGATTCCAGACGGTACTCTTGCCTACTTCGATGAGCAGGATCAGATGCAACAGGTTTCCATTCACTCTCTCGCCGCCGGCAAAAAGGTCGTTCTCTT...

CDS

Download CDS FASTA

489 bp · TkA01G458950|TK1151|CDS

ATGGCTCCGATCGCTGTTGGTGACAAGATTCCAGACGGTACTCTTGCCTACTTCGATGAGCAGGATCAGATGCAACAGGTTTCCATTCACTCTCTCGCCGCCGGCAAAAAGGTCGTTCTCTTTGGAGTCCCCGGCGCCTTCACTCCAACTTGCAGTATGAAGCATGTCCCGGGCTTCATTGAGAAATCCGACGACCTTAAATCAAAGGGCGTGGAGGAGCTTCTGTTGATTAGCGTAAACGATCCATTCGTGATGAAGGC...

Protein

Download Protein FASTA

162 aa · TkA01G458950|TK1151|PROTEIN

MAPIAVGDKIPDGTLAYFDEQDQMQQVSIHSLAAGKKVVLFGVPGAFTPTCSMKHVPGFIEKSDDLKSKGVEELLLISVNDPFVMKAWKKSYPETKNVKFLADGAAKYTHALGLELDLAEKGLGIRSRRFALLVDDLKVVVANIESGGEFTVSSADEILAAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G458950`
TK1151 ID	TkA01G458950
OH-1004 ID	LXL04_002525
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G458950

Location Chr01:114929873-114931154 (-)

Description Similar to Peroxiredoxin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g65980`	Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system.	No verified direct reference in this release
`At1g65970`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release
`At1g60740`	Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0675100`	Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002525 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0034599 cellular response to oxidative stress Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0008379 thioredoxin peroxidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G60740

ath:AT1G65970

ath:AT1G65980

dosa:Os01g0675100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.719

Rank 1 · TkA01G458950 · TK1151

Nucleus0.313

Rank 2 · TkA01G458950 · TK1151

Mitochondrion0.209

Rank 3 · TkA01G458950 · TK1151

Cell membrane0.066

Rank 4 · TkA01G458950 · TK1151

Peroxisome0.057

Rank 5 · TkA01G458950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08534Redoxin6-159 aa

PF00578AhpC-TSA6-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G458950	`PF08534`	Redoxin	6	159	6.4e-34	117.6
TkA01G458950	`PF00578`	AhpC-TSA	6	122	1e-13	52.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XEX2`	Arabidopsis thaliana	sp\|Q9XEX2\|PRX2B_ARATH Peroxiredoxin-2B	77.800%	Swiss-Prot	High
`Q9SRZ4`	Arabidopsis thaliana	sp\|Q9SRZ4\|PRX2C_ARATH Peroxiredoxin-2C	74.700%	Swiss-Prot	High
`O22711`	Arabidopsis thaliana	sp\|O22711\|PRX2D_ARATH Peroxiredoxin-2D	73.500%	Swiss-Prot	High
`Q9FR35`	Oryza sativa subsp. japonica	sp\|Q9FR35\|PRX2C_ORYSJ Peroxiredoxin-2C	74.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card