TkA01G458700 | RubberDandelionOmics

Gene overview

TkA01G458700

Reference: TK1151 Chr: Chr01 Coordinates: 114857361-114857738 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · TkA01G458700|TK1151|cDNA

ATGAAGACGATTTCACGCAGATTGAAAATCTTCATTTTCAATCTCTCTATCATTGTCCTCTTTTCATCAATTTTCTTATTTCGTTTCAGCAAACCCCCTAAGCACCAAACCCTAACCTCCGAAATATCACCAAAAGGACAAGAACAAGAAGGGACGGTAGCTCGGAGAAACTACATAGTTAGATTCATCGAGTACAAGAAAGCGGAGCATCACAAGGAGTATCTCCTGCAGAGCACGCAGGAGAAATTAAATGTTTCCTC...

CDS

Download CDS FASTA

378 bp · TkA01G458700|TK1151|CDS

ATGAAGACGATTTCACGCAGATTGAAAATCTTCATTTTCAATCTCTCTATCATTGTCCTCTTTTCATCAATTTTCTTATTTCGTTTCAGCAAACCCCCTAAGCACCAAACCCTAACCTCCGAAATATCACCAAAAGGACAAGAACAAGAAGGGACGGTAGCTCGGAGAAACTACATAGTTAGATTCATCGAGTACAAGAAAGCGGAGCATCACAAGGAGTATCTCCTGCAGAGCACGCAGGAGAAATTAAATGTTTCCTC...

Protein

Download Protein FASTA

125 aa · TkA01G458700|TK1151|PROTEIN

MKTISRRLKIFIFNLSIIVLFSSIFLFRFSKPPKHQTLTSEISPKGQEQEGTVARRNYIVRFIEYKKAEHHKEYLLQSTQEKLNVSSSSWEWINRNNPASKFPTDFGVVAIDDEAASSIIGSLRG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G458700`
TK1151 ID	TkA01G458700
OH-1004 ID	LXL04_002531
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.800
Protein coverage (%)	TK1151 99.200 / OH-1004 10.992 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G458700

Location Chr01:114857361-114857738 (+)

Description Similar to SBT6.1: Subtilisin-like protease SBT6.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19660`	Serine protease that catalyzes the first step (site-1 cleavage) in the proteolytic activation of various factors, prior to site-2 cleavage.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006606 protein import into nucleus Biological Process

GO:0006607 NLS-bearing protein import into nucleus Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006972 hyperosmotic response Biological Process

GO:0007040 lysosome organization Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0008203 cholesterol metabolic process Biological Process

GO:0016485 protein processing Biological Process

GO:0030968 endoplasmic reticulum unfolded protein response Biological Process

GO:0031293 membrane protein intracellular domain proteolysis Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

KEGG gene cross-reference

ath:AT5G19660

cge:100689417

hsa:8720

mmu:56453

rno:89842

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.359

Rank 1 · TkA01G458700 · TK1151

Golgi apparatus0.164

Rank 2 · TkA01G458700 · TK1151

Cytoplasm0.155

Rank 3 · TkA01G458700 · TK1151

Nucleus0.147

Rank 4 · TkA01G458700 · TK1151

Plastid0.121

Rank 5 · TkA01G458700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29344Expansin_middle8-19 aa

PF23001MBTP1_N54-119 aa

PF29344Expansin_middle79-116 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G458700	`PF29344`	Expansin_middle	8	19	0.085	13.7
TkA01G458700	`PF23001`	MBTP1_N	54	119	3.2e-17	63.3
TkA01G458700	`PF29344`	Expansin_middle	79	116	0.085	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUG6`	Arabidopsis thaliana	sp\|Q0WUG6\|SBT61_ARATH Subtilisin-like protease SBT6.1	37.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card