TkA01G457380 | RubberDandelionOmics

Gene overview

TkA01G457380

Reference: TK1151 Chr: Chr01 Coordinates: 114522799-114525112 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1518 bp · TkA01G457380|TK1151|cDNA

GGAAAATCTGAAAACCATAGAATAGTTCTGGGACCATTTATGCGGTTTTAGAAAGCAACACCGTCCCTGTACTAGAGAACGGTTCATAGCCGTTTAACGGGCTGTTCCGAGAGCGGCGAGGTGGAGCGCGATGGAAGAACCGTCGGTGACGCCGCCTACACAGTGACCCTGTTGAAGAGAGAGGATTGTAAGCGCACCAAACATGATTCTGCTTTCTCGGAATGGAAGATCCTTATTGGGCCTCATGATTGGGAGGATTA...

CDS

Download CDS FASTA

810 bp · TkA01G457380|TK1151|CDS

ATGGATAATAAAAAGGACGCCGAGAAAACAGAGTCCCAGCTTTTAAAAACCTTCGATTACGCATGGAACCGAGGGATGAACAGGGACCGCCGCCCTCTCGACATCCATAAAAAACTCGACGCTCTCTCAAACACTAAATCGGTACCTTTCGTGTTCAAAAAGCTTCACGTCGTCCGTCCCAAAAAGGTCGGACTTAACATCAAACACTGCGACCCACCCGTTTTGGAAAACGGATCCAACTTCTATACAAATCAGAACAA...

Protein

Download Protein FASTA

269 aa · TkA01G457380|TK1151|PROTEIN

MDNKKDAEKTESQLLKTFDYAWNRGMNRDRRPLDIHKKLDALSNTKSVPFVFKKLHVVRPKKVGLNIKHCDPPVLENGSNFYTNQNNRNIVARIFKFTRSRPTMVSISNDCDINNSDDRKCGVALGHGSICTRTPVEGRKRCVDHKGMKVNASVKTTNTENCCGVSLDDGCICTKVAVKGRKRCEEHKGMRIGGRILRSGSDLKIGGFCDMEGEKGIMVNGGIGVDSLSCVAVTRKGSVCRRKRGENSKYCWQHDEMRAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G457380`
TK1151 ID	TkA01G457380
OH-1004 ID	LXL04_002449
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.000
Protein coverage (%)	TK1151 96.654 / OH-1004 58.559 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G457380

Location Chr01:114522799-114525112 (+)

Description Similar to ET2: Protein EFFECTOR OF TRANSCRIPTION 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56780`	Transcriptional regulator involved in the regulation of cell differentiation in meristems.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002449 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010089 xylem development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:2000033 regulation of seed dormancy process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0097100 supercoiled DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G26170

ath:AT5G56770

ath:AT5G56780

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.911

Rank 1 · TkA01G457380 · TK1151

Cytoplasm0.130

Rank 2 · TkA01G457380 · TK1151

Cell membrane0.028

Rank 3 · TkA01G457380 · TK1151

Plastid0.017

Rank 4 · TkA01G457380 · TK1151

Mitochondrion0.014

Rank 5 · TkA01G457380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19239GIY_YIG_domain1-35 aa

PF11722zf-TRM13_CCCH131-146 aa

PF08879WRC131-149 aa

PF08879WRC173-187 aa

PF11722zf-TRM13_CCCH176-188 aa

PF11722zf-TRM13_CCCH235-254 aa

PF08879WRC240-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G457380	`PF19239`	GIY_YIG_domain	1	35	3.5e-11	43.9
TkA01G457380	`PF11722`	zf-TRM13_CCCH	131	146	0.64	10.4
TkA01G457380	`PF08879`	WRC	131	149	0.79	10.2
TkA01G457380	`PF08879`	WRC	173	187	0.79	10.2
TkA01G457380	`PF11722`	zf-TRM13_CCCH	176	188	0.64	10.4
TkA01G457380	`PF11722`	zf-TRM13_CCCH	235	254	0.64	10.4
TkA01G457380	`PF08879`	WRC	240	255	0.79	10.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K933`	Arabidopsis thaliana	sp\|F4K933\|ET2_ARATH Protein EFFECTOR OF TRANSCRIPTION 2	40.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card