TkA01G457030 | RubberDandelionOmics

Gene overview

TkA01G457030

Reference: TK1151 Chr: Chr01 Coordinates: 114436399-114440622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3261 bp · TkA01G457030|TK1151|cDNA

AGCACCCCTGCGAGTCAGTATCCATGATTCAAAGCAACCTCCTCCCTCTTCTTCTAAAGAATAAGGTTCATTAAATGTGTCCTTAAACACCTTATAATAACTATAATAATCAATACAGAGAGAGAGAGAGAGAGAGTTCTAAATTCCACTTTCATTCATTGACTCAATAATATTTGTATTATTCAGAGACGTGGGACACACCTGTCATTACTTTAAGCATCATGTCCCTTCCAGGCTTTGTTTTTTTTTGCTCGCTTCAC...

CDS

Download CDS FASTA

1932 bp · TkA01G457030|TK1151|CDS

ATGATGAAGAGGCAAAAGAGTGGTACAGTTAGAGATCATACCGGAGAAAGAATTGTGCTTATTGCAGTGAAAGCATCAAAAGAAATTTCGAAAGACGCTTTTATTTGGGCCTTAACACATGTCGTTCAGCCTGGCGATTGTGCTAAGTTACTGGTCGTCATTCCTGCTCACACCTCAACTCACAAGTTATGGGGTTTCTCAAAATTCAACAGCGATTGCACCACTGGGCAATGGATACATCTTTCAGGCGATTTTAGGGA...

Protein

Download Protein FASTA

643 aa · TkA01G457030|TK1151|PROTEIN

MMKRQKSGTVRDHTGERIVLIAVKASKEISKDAFIWALTHVVQPGDCAKLLVVIPAHTSTHKLWGFSKFNSDCTTGQWIHLSGDFRDQKDDITELCSQMMFQLHDIYDSDKIKMKIKVISGSPCGVVAAEAKKTRTQWVVLDKHLKKEAKACIEELECNVVVMKNARPKVLRLNLVGSPTKDPEVLTTCQETPPDYPKEDERTWNTTKVPNVTPVSSPEHLSFTTTEHTTPSLSSSDLGFSPFLVSDHDWYTKKDGINDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G457030`
TK1151 ID	TkA01G457030
OH-1004 ID	LXL04_002447
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G457030

Location Chr01:114436399-114440622 (-)

Description Similar to PERK12: Proline-rich receptor-like protein kinase PERK12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g70460`	Negatively regulates root hair elongation.	No verified direct reference in this release
`At1g23540`	Regulates the auxin-related MAX (More Axillary Growth) pathway during the shoot branching.	Over-expression of the IGI1 leading to altered shoot-branching development related to MAX pathway in Arabidopsis.2010 · DOI: 10.1007/s11103-010-9645-0
`At5g38560`	Could be involved in the negative regulation of root growth.	PERK-KIPK-KCBP signalling negatively regulates root growth in Arabidopsis thaliana.2015 · DOI: 10.1093/jxb/eru390
`At1g10620`	Putative proline-rich receptor-like protein kinase PERK11.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002447 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0007165 signal transduction Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0032502 developmental process Biological Process

GO:1990641 response to iron ion starvation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT1G23540

ath:AT1G26150

ath:AT1G70460

ath:AT5G38560

smo:SELMODRAFT_444075

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.608

Rank 1 · TkA01G457030 · TK1151

Nucleus0.281

Rank 2 · TkA01G457030 · TK1151

Cytoplasm0.274

Rank 3 · TkA01G457030 · TK1151

Endoplasmic reticulum0.043

Rank 4 · TkA01G457030 · TK1151

Plastid0.029

Rank 5 · TkA01G457030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29992RIM13_calpain-like_second102-152 aa

PF07714PK_Tyr_Ser-Thr116-172 aa

PF07714PK_Tyr_Ser-Thr373-634 aa

PF00069Pkinase373-634 aa

PF03109ABC1374-396 aa

PF03109ABC1474-515 aa

PF01636APH486-518 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G457030	`PF29992`	RIM13_calpain-like_second	102	152	0.03	14.9
TkA01G457030	`PF07714`	PK_Tyr_Ser-Thr	116	172	6.4e-42	144.4
TkA01G457030	`PF07714`	PK_Tyr_Ser-Thr	373	634	6.4e-42	144.4
TkA01G457030	`PF00069`	Pkinase	373	634	1.2e-39	137.0
TkA01G457030	`PF03109`	ABC1	374	396	0.00024	21.1
TkA01G457030	`PF03109`	ABC1	474	515	0.00024	21.1
TkA01G457030	`PF01636`	APH	486	518	0.048	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9CAL8`	Arabidopsis thaliana	sp\|Q9CAL8\|PEK13_ARATH Proline-rich receptor-like protein kinase PERK13	52.000%	Swiss-Prot	Low
`Q9ZUE0`	Arabidopsis thaliana	sp\|Q9ZUE0\|PEK12_ARATH Proline-rich receptor-like protein kinase PERK12	52.000%	Swiss-Prot	Low
`Q9FFW5`	Arabidopsis thaliana	sp\|Q9FFW5\|PERK8_ARATH Proline-rich receptor-like protein kinase PERK8	51.900%	Swiss-Prot	Low
`Q9SGY7`	Arabidopsis thaliana	sp\|Q9SGY7\|PEK11_ARATH Putative proline-rich receptor-like protein kinase PERK11	45.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card