RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G452600
Reference: TK1151 Chr: Chr01 Coordinates: 113253730-113255728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1215 bp · TkA01G452600|TK1151|cDNA

AAGAAGGCATTGTTTATATTTTTCCCTCTTGAAAATAAACCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCGATCTTCTGCTTTTGGTTTTTTGTATTAATGGCTGCTCAATATCCCTTATGAAAAACTGCAATCGATTCCAGTTTTTGTCAGTTGACGCAAAATCGCATTAGGTGATATCACCAGGTCAAACCTGTTCGGAGAACGACGACAATGGACAGTGGAGGCCGTGGTGGTGTGTACAATCCAAGGACTGTCG...

CDS

Download CDS FASTA

771 bp · TkA01G452600|TK1151|CDS

ATGGACAGTGGAGGCCGTGGTGGTGTGTACAATCCAAGGACTGTCGAAGAAGTTTACAGAGATTACCAAGGGCGTCGTAACGGCTTGATAAAAGCCCTAACAACAGATGTTGAGCGATTTTATCGGCAGTGCGATCCTGAGAAGGAAAACCTTTGCTTATACGGATTCCCTAGTGAACAATGGGAGGTTAACCTACCAGCAGAAGAGGTCCCTCCAGAGCTCCCTGAACCTGCATTAGGCATCAACTTTGCACGTGATGG...

Protein

Download Protein FASTA

256 aa · TkA01G452600|TK1151|PROTEIN

MDSGGRGGVYNPRTVEEVYRDYQGRRNGLIKALTTDVERFYRQCDPEKENLCLYGFPSEQWEVNLPAEEVPPELPEPALGINFARDGMPENDWLSLVAVHSDAWLLSVAYYFGARFGFDKSDRKRLFSMINDLPTVFEVVGVYAKKQTTEKSSFSNHSTNKSKSNTKGRGSESQLKYAKMQGKDEEDDLEEEDEDEHGDTLCGACGENYASDEFWICCDICERWFHGKCVKITPARAEHIKQYKCPSCSSNKRARP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G452600
TK1151 IDTkA01G452600
OH-1004 IDLXL04_002359
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)100.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G452600
LocationChr01:113253730-113255728 (-)
DescriptionSimilar to AL5: PHD finger protein ALFIN-LIKE 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g20510 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. No verified direct reference in this release
At5g26210 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8B8C5 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. No verified direct reference in this release
Os07g0608400 Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_002359 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006325 chromatin organization Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009651 response to salt stress Biological Process
GO:0045727 positive regulation of translation Biological Process
GO:0071472 cellular response to salt stress Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0003677 DNA binding Molecular Function
GO:0003712 transcription coregulator activity Molecular Function
GO:0003714 transcription corepressor activity Molecular Function
KEGG gene cross-reference
ath:AT3G42790
ath:AT5G20510
dosa:Os04g0444900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.871
Rank 1 · TkA01G452600 · TK1151
Cytoplasm0.217
Rank 2 · TkA01G452600 · TK1151
Cell membrane0.032
Rank 3 · TkA01G452600 · TK1151
Mitochondrion0.029
Rank 4 · TkA01G452600 · TK1151
Endoplasmic reticulum0.017
Rank 5 · TkA01G452600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12165Alfin14-140 aa
PF14721AIF_C137-192 aa
PF30811PHD_UBR7-like192-208 aa
PF03107C1_2193-230 aa
PF00130C1_1199-235 aa
PF22908PHD_NSD201-246 aa
PF13639zf-RING_2201-248 aa
PF00628PHD202-248 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA01G452600PF12165Alfin141403.7e-67224.6
TkA01G452600PF14721AIF_C1371920.511.6
TkA01G452600PF30811PHD_UBR7-like1922080.0006120.4
TkA01G452600PF03107C1_21932300.06114.4
TkA01G452600PF00130C1_11992356.37.4
TkA01G452600PF22908PHD_NSD2012460.312.1
TkA01G452600PF13639zf-RING_22012480.411.7
TkA01G452600PF00628PHD2022482.3e-0937.9
TkA01G452600PF31197PHD_JHD12022440.0001822.1
TkA01G452600PF27108PHD_Pygo2022480.002918.4
TkA01G452600PF21257PHD_ash2p_like2022153.68.3
TkA01G452600PF30811PHD_UBR7-like2112510.0006120.4
TkA01G452600PF21257PHD_ash2p_like2172343.68.3
TkA01G452600PF00130C1_12412496.37.4
TkA01G452600PF03107C1_22422490.06114.4
TkA01G452600PF23165zf-C2H2_FBX412422530.2811.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q5XEM9Arabidopsis thalianasp|Q5XEM9|ALFL5_ARATH PHD finger protein ALFIN-LIKE 572.500%Swiss-ProtHigh
O81488Arabidopsis thalianasp|O81488|ALFL4_ARATH PHD finger protein ALFIN-LIKE 470.800%Swiss-ProtHigh
B8B8C5Oryza sativa subsp. indicasp|B8B8C5|ALFL9_ORYSI PHD finger protein ALFIN-LIKE 963.600%Swiss-ProtHigh
Q6YTY3Oryza sativa subsp. japonicasp|Q6YTY3|ALFL9_ORYSJ PHD finger protein ALFIN-LIKE 963.400%Swiss-ProtHigh

JBrowse

View in Genome Browser