Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1058 bp · TkA01G449220|TK1151|cDNA
AAAAAATAACTTTACCCTACCCTAATTCTCTAAACCGGCGAGTCTTCACCTCGTTATACAACTTGTGCCCTAAAATTTGATTTCTAATTCACCCGCCTCCATACTCCCTCTTGGCCGCTACTCGCCTCCTGCTTCCAAATCCATTGAACTTTGTTGCTCCAGTTCATCCGGCGACTTCACCCCGGTTCTCCTTCTTCTCCGGCGACTTCACCTTGGTTCGGCCGTTCTCCTTGACAGGCGCGACAGCTTCACATCGGACG...
348 bp · TkA01G449220|TK1151|CDS
ATGGCAAGTAGAAGTAGAGGTGTATCGAAGTCGCCGGAAGATCATGGCCTTCTCCAGTTACAGATATTCTGCGGATTCGCTTACCTCCCTCTATTGAAAAACAACAGGTTTCTTCAAAATTTCTGTCGACTCTGGATCCATGCAGCTGGTAAGGTTCCAGAACCTGAAACAATCAAAGCAATGGAGGACTTCTACAGACAGTTATATGAGTTAGATGGAGTTACCGATCTCAAGTTCCCAGAACATTATCCAGTTTCAAG...
Protein
Download Protein FASTA115 aa · TkA01G449220|TK1151|PROTEIN
MASRSRGVSKSPEDHGLLQLQIFCGFAYLPLLKNNRFLQNFCRLWIHAAGKVPEPETIKAMEDFYRQLYELDGVTDLKFPEHYPVSRLLGCVEVVGCVTSEELTSWEDIPQGVGI
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G449220 |
|---|---|
| TK1151 ID | TkA01G449220 |
| OH-1004 ID | LXL04_023037 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 98.600 |
| Protein coverage (%) | TK1151 60.870 / OH-1004 22.654Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G449220 |
|---|---|
| Location | Chr01:112475145-112476714 (-) |
| Description | Similar to Trip4: Activating signal cointegrator 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0030520 estrogen receptor signaling pathway Biological Process GO:0032790 ribosome disassembly Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0072344 rescue of stalled cytosolic ribosome Biological Process GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component |
| KEGG gene cross-reference | hsa:9325 mmu:56404 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04266ASCH43-106 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G449220 | PF04266 | ASCH | 43 | 106 | 0.016 | 16.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.