TkA01G447440 | RubberDandelionOmics

Gene overview

TkA01G447440

Reference: TK1151 Chr: Chr01 Coordinates: 112022423-112024734 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1574 bp · TkA01G447440|TK1151|cDNA

ATCTGGTTACGCGAATTTTTCTTTCAAGTTTTAACCCTTCTTCTCGTTTGCTTTTTATTACAGGAATTTGCGGCAACGTGGAACCAAAAACTCCCCCAAAATCAAAGAACCACATTTTCACGTACACAAGAATTGAAAGCATCCCCCCTCTTCTCTTCCTCCATCTGTGCCTGTTTACACCAAACCATTGCAAATGTATCGATCGGCAGCGAAACGGTTGCTTCCCTATTCATCTTCTTTCTCCGTTAAACAATGCTTAC...

CDS

Download CDS FASTA

513 bp · TkA01G447440|TK1151|CDS

ATGTATCGATCGGCAGCGAAACGGTTGCTTCCCTATTCATCTTCTTTCTCCGTTAAACAATGCTTACAAGCCTCTCGACTGCCAATCACAAGGCCTCGTTTTCGGTTTCTCTCATCGGCGACATCGGACCCACCTTTCCCGAACGGTTTCAACACCACCACCTCATCTTCATCCACCCAAACAGATGAATTTCGCAATCCTTCTGATAGTGGTGCCTCAAGGAGAACCACACCTAGGGCCAATTACGAAGAGGAACAAGC...

Protein

Download Protein FASTA

170 aa · TkA01G447440|TK1151|PROTEIN

MYRSAAKRLLPYSSSFSVKQCLQASRLPITRPRFRFLSSATSDPPFPNGFNTTTSSSSTQTDEFRNPSDSGASRRTTPRANYEEEQARVLAASLLHVFRLGWTEAAMIAGARDAGVSPSIVGSIPQKEAALVEYFMDECLQKLIDTIDSGTYNYKTWYQVSALQSLLNVA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G447440`
TK1151 ID	TkA01G447440
OH-1004 ID	LXL04_002304
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 88.235 / OH-1004 50.680 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G447440`
Location	Chr01:112022423-112024734 (-)
Description	Similar to coq9-b: Ubiquinone biosynthesis protein COQ9-B, mitochondrial
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002304` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006120 mitochondrial electron transport, NADH to ubiquinone Biological Process GO:0006744 ubiquinone biosynthetic process Biological Process GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0110142 ubiquinone biosynthesis complex Cellular Component GO:0008047 enzyme activator activity Molecular Function GO:0008289 lipid binding Molecular Function GO:0019840 isoprenoid binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	hsa:57017 mmu:67914 rno:498909 xla:496049 xtr:496601 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.691

Rank 1 · TkA01G447440 · TK1151

Plastid0.224

Rank 2 · TkA01G447440 · TK1151

Nucleus0.083

Rank 3 · TkA01G447440 · TK1151

Cytoplasm0.051

Rank 4 · TkA01G447440 · TK1151

Cell membrane0.012

Rank 5 · TkA01G447440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21392COQ9_N86-111 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G447440	`PF21392`	COQ9_N	86	111	0.00041	20.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card