TkA01G447300 | RubberDandelionOmics

Gene overview

TkA01G447300

Reference: TK1151 Chr: Chr01 Coordinates: 111979702-111983120 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2151 bp · TkA01G447300|TK1151|cDNA

ATAAGAACCAAAAGGTGACCATATTAATTGAAATCGATTGCTACAACGTGGGAGGGTTTGGACGCTTTACCATCGTCTTCTTCTGTTCATATCGTTTCTCTATATATTCAAACAAGATAACTACGATTGGATCTTGATTCAACTTCTTCAACTCATTTTCGTTGTAATTTAAAGAGGAAATTCCAACCGCTTTCTGGATTGGTCCTCAATTCAAGGGCTCATATTCATTCCGAGGTCCATTCAGATATGGATCTGAGAAG...

CDS

Download CDS FASTA

1341 bp · TkA01G447300|TK1151|CDS

ATGAAAGGAGTAGGAGGAGGCTACTTCTATGGACTGAAGATGAATCAGCTCTCTCTCTTCTTCATCGTTTTCGTTTGTGCTTCCATTGTAGTCTGGAATTGGGAGAAAACCCCTCGTCTTACAACTCTCCTTCCACCTCATGATCAATCGTTACATATTTTTCCAGATGAACTGAAAAGGGAACATATCGCAGAAGTAAAAGACGATTTTAAGAAAGATGAACCCGTCATTAATACACTCCCACCATCACTTTCAACAAA...

Protein

Download Protein FASTA

446 aa · TkA01G447300|TK1151|PROTEIN

MKGVGGGYFYGLKMNQLSLFFIVFVCASIVVWNWEKTPRLTTLLPPHDQSLHIFPDELKREHIAEVKDDFKKDEPVINTLPPSLSTNTASFNTRQDESPTTQQENHHEKSDIIENSISEENDGSKPFKPQLIASVTSHSTESAVSEQIDTPISNAENQVCNFGKGKWIPAENRPLYSGFGCKQWLSGMWACRLTQRTDFGYEKLKWQPKDCNIEDFTGPNFLKRMQHKTLAFVGDSLGRQQFQSLMCMVTGGEEMLDVED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G447300`
TK1151 ID	TkA01G447300
OH-1004 ID	LXL04_002305
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 94.843 / OH-1004 85.081 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G447300

Location Chr01:111979702-111983120 (+)

Description Similar to TBL16: Protein trichome birefringence-like 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20680`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g64020`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At2g37720`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At3g06080`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At5g06230`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002305 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007623 circadian rhythm Biological Process

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0045492 xylan biosynthetic process Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G37720

ath:AT3G06080

ath:AT5G06230

ath:AT5G20680

ath:AT5G64020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.763

Rank 1 · TkA01G447300 · TK1151

Endoplasmic reticulum0.092

Rank 2 · TkA01G447300 · TK1151

Extracellular0.069

Rank 3 · TkA01G447300 · TK1151

Cell membrane0.067

Rank 4 · TkA01G447300 · TK1151

Cytoplasm0.048

Rank 5 · TkA01G447300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24536NXPE4_C101-118 aa

PF14416PMR5N159-212 aa

PF24536NXPE4_C206-252 aa

PF13839PC-Esterase215-420 aa

PF14416PMR5N418-427 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G447300	`PF24536`	NXPE4_C	101	118	0.033	14.5
TkA01G447300	`PF14416`	PMR5N	159	212	3.4e-13	50.4
TkA01G447300	`PF24536`	NXPE4_C	206	252	0.033	14.5
TkA01G447300	`PF13839`	PC-Esterase	215	420	5.5e-44	151.9
TkA01G447300	`PF14416`	PMR5N	418	427	3.4e-13	50.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K5L5`	Arabidopsis thaliana	sp\|F4K5L5\|TBL16_ARATH Protein trichome birefringence-like 16	49.300%	Swiss-Prot	Medium
`Q0WPS0`	Arabidopsis thaliana	sp\|Q0WPS0\|TBL14_ARATH Protein trichome birefringence-like 14	61.300%	Swiss-Prot	Medium
`O80940`	Arabidopsis thaliana	sp\|O80940\|TBL15_ARATH Protein trichome birefringence-like 15	55.300%	Swiss-Prot	Medium
`Q9LDG2`	Arabidopsis thaliana	sp\|Q9LDG2\|TBL10_ARATH Protein trichome birefringence-like 10	31.300%	Swiss-Prot	Medium
`Q9FFZ4`	Arabidopsis thaliana	sp\|Q9FFZ4\|TBL9_ARATH Protein trichome birefringence-like 9	30.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card