TkA01G444670 | RubberDandelionOmics

Gene overview

TkA01G444670

Reference: TK1151 Chr: Chr01 Coordinates: 111282387-111288581 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5079 bp · TkA01G444670|TK1151|cDNA

GATTCACTTCCATTGTTTATGTGTACCTGCTTCCACCCATCAAATTATAGATCACCACCACCCTCCCCCACAACCGTTTATCTGCACACCTTTCCATTCACCGTCAAATGCCTTCATCTTCCTCCCTGTTTATTTCTTCCCGCCGGATCATGAGAGTCGACTTTTTGCTTTTCAGCATGAAATTTTGAGTTCAATATCAACAGAAAAAATGAGCCTGAAATGGAATATAGTGGTAGGATCTAATATGCGGGCATCGCAAG...

CDS

Download CDS FASTA

4806 bp · TkA01G444670|TK1151|CDS

ATGAGCCTGAAATGGAATATAGTGGTAGGATCTAATATGCGGGCATCGCAAGTAAACATTATATTTAAACTCAACTCTACAAGTTTCCATCGACCATGGAGACGGAAAATGTCCAGATACCTTGTGATACGCAGCAACCATCAGTTAAGTTCATCTTCATATTCATCATCACAGGACAATTTATTCCATGCCTGTCTTTCTCAACTGAATTCACTGGATTTGCTTGCTCCAGCCCTAGGTTTCACCACTGCTCTCGCTAT...

Protein

Download Protein FASTA

1601 aa · TkA01G444670|TK1151|PROTEIN

MSLKWNIVVGSNMRASQVNIIFKLNSTSFHRPWRRKMSRYLVIRSNHQLSSSSYSSSQDNLFHACLSQLNSLDLLAPALGFTTALAILYNSTTRNHLSNRIGEWNLFTSPTPFNRFVKLRCESLLLEDSNEKLVDEDGHPVSFDSGPIQQTDVNDYTNDVFGEQISYQRICISTDDGGVVSLDWPSNLELSNEHGLDTTVLVVPGTTDGSMDEDIRSFVYECLKRGCFPIVMNPRGCARSPLTTPRLFTAADSDDVCTSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G444670`
TK1151 ID	TkA01G444670
OH-1004 ID	LXL04_002280
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G444670`
Location	Chr01:111282387-111288581 (-)
Description	Similar to EMB8: Embryogenesis-associated protein EMB8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002280` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0046470 phosphatidylcholine metabolic process Biological Process GO:0051792 medium-chain fatty acid biosynthetic process Biological Process GO:0051793 medium-chain fatty acid catabolic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0008126 acetylesterase activity Molecular Function GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function GO:0034338 short-chain carboxylesterase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	bta:510774 bta:539795 hsa:171586 hsa:84696 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.811

Rank 1 · TkA01G444670 · TK1151

Nucleus0.083

Rank 2 · TkA01G444670 · TK1151

Endoplasmic reticulum0.065

Rank 3 · TkA01G444670 · TK1151

Golgi apparatus0.058

Rank 4 · TkA01G444670 · TK1151

Mitochondrion0.051

Rank 5 · TkA01G444670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18469PH_1817-70 aa

PF00561Abhydrolase_1199-308 aa

PF24930DUF7750563-627 aa

PF18469PH_18867-898 aa

PF07895DUF1673894-922 aa

PF02517Rce1-like1292-1321 aa

PF07895DUF16731340-1437 aa

PF02517Rce1-like1445-1526 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G444670	`PF18469`	PH_18	17	70	0.092	13.5
TkA01G444670	`PF00561`	Abhydrolase_1	199	308	0.023	15.1
TkA01G444670	`PF24930`	DUF7750	563	627	6.6e-35	119.5
TkA01G444670	`PF18469`	PH_18	867	898	0.092	13.5
TkA01G444670	`PF07895`	DUF1673	894	922	0.23	12.1
TkA01G444670	`PF02517`	Rce1-like	1292	1321	1.6e-05	25.8
TkA01G444670	`PF07895`	DUF1673	1340	1437	0.23	12.1
TkA01G444670	`PF02517`	Rce1-like	1445	1526	1.6e-05	25.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card