TkA01G441100 | RubberDandelionOmics

Gene overview

TkA01G441100

Reference: TK1151 Chr: Chr01 Coordinates: 110231722-110235248 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1669 bp · TkA01G441100|TK1151|cDNA

GTTGTATCAATTAGCACACACATAGGTGGAAGTCGTTCCACGGGCATATCAAGTCTTCACAAACATCTCCTCACTCTCCCTTCAGTCTTCCCCTCATTGTACTCTGCATCTGGTGAAGAAAAAATGGGAGCAACAGATGCAGATTCCACGAAGAAGAAGGAGATGGTTCATTCCCCTATTCTAACTTACTTCTCTGTCATCACTCTTCTCTCTACTTGCCCTCCTTTTCATTCTCCTATGGTACACAATGGTACATCTCG...

CDS

Download CDS FASTA

510 bp · TkA01G441100|TK1151|CDS

ATGGTACATCTCGATGGCTCTTTACTTAACACATTCAATTATCTCATGGAGAATGGAGTTGAAGGATTTGTGAACATATGGCCTAAACCTACTGCAATTGCATGGAAGATCATTGCTTGTTATGGTCTCTTTGAAGCAGCCCTGCAGCTTTGGTTACCTGGAAAAAGAGTTGAAGGACCAATATCGCCAACAGGCAATAACCAGTCTACAAGGCTAATGGTGTCGCAGCATATGTGGGTGACACTGATTACATATGTTAG...

Protein

Download Protein FASTA

169 aa · TkA01G441100|TK1151|PROTEIN

MVHLDGSLLNTFNYLMENGVEGFVNIWPKPTAIAWKIIACYGLFEAALQLWLPGKRVEGPISPTGNNQSTRLMVSQHMWVTLITYVSLWWFGIFNPTVVYDHLGEIYSALIFGSFIFCIFLYIKGHVAPSSTDSGSSGNIIFDFYWGMELYPRIGKILISKFSPIVDSG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G441100`
TK1151 ID	TkA01G441100
OH-1004 ID	LXL04_002242
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	91.700
Protein coverage (%)	TK1151 92.308 / OH-1004 32.636 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G441100

Location Chr01:110231722-110235248 (+)

Description Similar to DWF5: 7-dehydrocholesterol reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50430`	Production of cholesterol by reduction of C7-C8 double bond of 7-dehydrocholesterol (7-DHC).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002242 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0016132 brassinosteroid biosynthetic process Biological Process

GO:0030154 cell differentiation Biological Process

GO:0033489 cholesterol biosynthetic process via desmosterol Biological Process

GO:0033490 cholesterol biosynthetic process via lathosterol Biological Process

GO:0035264 multicellular organism growth Biological Process

GO:0042127 regulation of cell population proliferation Biological Process

GO:0045540 regulation of cholesterol biosynthetic process Biological Process

GO:0160020 positive regulation of ferroptosis Biological Process

KEGG gene cross-reference

ath:AT1G50430

mmu:13360

rno:64191

xla:379273

xtr:394844

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.822

Rank 1 · TkA01G441100 · TK1151

Cytoplasm0.068

Rank 2 · TkA01G441100 · TK1151

Nucleus0.059

Rank 3 · TkA01G441100 · TK1151

Mitochondrion0.053

Rank 4 · TkA01G441100 · TK1151

Golgi apparatus0.034

Rank 5 · TkA01G441100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01222ERG4_ERG2424-163 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G441100	`PF01222`	ERG4_ERG24	24	163	1.2e-17	64.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDU6`	Arabidopsis thaliana	sp\|Q9LDU6\|ST7R_ARATH 7-dehydrocholesterol reductase	72.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card