TkA01G440980 | RubberDandelionOmics

Gene overview

TkA01G440980

Reference: TK1151 Chr: Chr01 Coordinates: 110191957-110196185 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · TkA01G440980|TK1151|cDNA

ACCTGTACTACTCAGCCCCCTGGAAATATAATGTATGCAGCTTTGGTGATTGGTGGCTCATTCATTATTGAAGGTGCTTCTCTTGCTGTGGCTGTGCATGCTGTCAGAAAAGGTGCAGCTGCAGAAGGCATGACATTGAGAGACTATGTGTGGCGTGGACATGATCCCACATCTGTTGCAGTCATGACAGAGGATGGTGCTGCTGTTACTGGCCTTGTGATAGCAGCAGCATCATTAGTTGCTGTGAATCTGACAGGCAA...

CDS

Download CDS FASTA

747 bp · TkA01G440980|TK1151|CDS

ATGGCTTCACAGCCCCCTGGAAATATAATGTATGCAGCTTTGGTGATTGGTGGCTCATTCATTATTGAAGGTGCTTCTCTTGCTGTGGCTGTGCATGCTGTCAGAAAAGGTGCAGCTGCAGAAGGCATGACATTGAGAGACTATGTGTGGCGTGGACATGATCCCACATCTGTTGCAGTCATGACAGAGGATGGTGCTGCTGTTACTGGCCTTGTGATAGCAGCAGCATCATTAGTTGCTGTGAATCTGACAGGCAATCC...

Protein

Download Protein FASTA

248 aa · TkA01G440980|TK1151|PROTEIN

MASQPPGNIMYAALVIGGSFIIEGASLAVAVHAVRKGAAAEGMTLRDYVWRGHDPTSVAVMTEDGAAVTGLVIAAASLVAVNLTGNPIYDPIGSIIVGNLLGVVAIFLIQRNRHALIGRAIDDHDMKRVLEFLKNDPVVDSVYDCKSEVIGPGFFRFKAEIDFNGVILVQNYLSRTGPEEWAKKFRNAANEKDDAEMLRTMSLYGEEVVTALGSEVDRLEKEIQEIVPGIRHVDIEAHNPIIPFPPLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G440980`
TK1151 ID	TkA01G440980
OH-1004 ID	LXL04_002237
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.194 / OH-1004 53.017 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G440980

Location Chr01:110191957-110196185 (-)

Description Similar to MTPC4: Metal tolerance protein C4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51610`	Involved in sequestration of excess metal in the cytoplasm into vacuoles to maintain metal homeostasis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006289 nucleotide-excision repair Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0010821 regulation of mitochondrion organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0031410 cytoplasmic vesicle Cellular Component

KEGG gene cross-reference

ath:AT1G51610

dre:497184

hsa:10463

pon:100172026

xla:447051

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.371

Rank 1 · TkA01G440980 · TK1151

Cytoplasm0.241

Rank 2 · TkA01G440980 · TK1151

Mitochondrion0.191

Rank 3 · TkA01G440980 · TK1151

Cell membrane0.190

Rank 4 · TkA01G440980 · TK1151

Golgi apparatus0.138

Rank 5 · TkA01G440980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01545Cation_efflux4-116 aa

PF26992DUF831849-101 aa

PF11021DUF261366-81 aa

PF11021DUF261392-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G440980	`PF01545`	Cation_efflux	4	116	8.7e-06	26.3
TkA01G440980	`PF26992`	DUF8318	49	101	0.098	13.5
TkA01G440980	`PF11021`	DUF2613	66	81	0.23	12.3
TkA01G440980	`PF11021`	DUF2613	92	109	0.23	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1G3`	Arabidopsis thaliana	sp\|Q8H1G3\|MTPC4_ARATH Metal tolerance protein C4	78.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card