Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1810 bp · TkA01G440970|TK1151|cDNA
TAGGTGACTAGATCTTGTATTAAATATGGAGGGTACGATGTGCAATTCACCCATGTGAACTCCTGCCATGTACATAGATCAAATCAAGCTTATCTCCCTTTCTCTTATATAATCTAAACAACTGCATTTTCTCAATTGCTCCTTCTTTCTGGACTGTGACGTGAGAAAAGAGACTGTCTTTTTTTCCTTTTATAAAGAGGGAACTGAAGCAAGCTACTTGATTCCTTCATCCATGGTGGTGGCGCTGTAGTATTACTACA...
333 bp · TkA01G440970|TK1151|CDS
ATGGGAATAGATCCGAGGCAGATAGTGGCAGGGGTGCTTACAGTCACCATGTTTCTAATGCTTGGCAATATGATTAAGCGTGACCATTATGATGCTCCCATTTCTCATCATGTCAACCATGCCGGATCTACCCAAAGTTTTGAAGACGCCATGGATTCCGAGAGAAGCCTTGTGGTTGATGACGACGGCCCTCAGAAGGAGGACGGAGCCGGTCTCAAGCCTTGTTGGTCCAAGCCAGGTTTTGAAGAAGATGAAGACTC...
Protein
Download Protein FASTA110 aa · TkA01G440970|TK1151|PROTEIN
MGIDPRQIVAGVLTVTMFLMLGNMIKRDHYDAPISHHVNHAGSTQSFEDAMDSERSLVVDDDGPQKEDGAGLKPCWSKPGFEEDEDSKGFVTFSLPTDLNTMSPRLQMLW
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G440970 |
|---|---|
| TK1151 ID | TkA01G440970 |
| OH-1004 ID | LXL04_002961 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 64.500 |
| Protein coverage (%) | TK1151 28.182 / OH-1004 5.939Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G440970 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:110189231-110191503 (+) | |||||||||
| Description | Similar to MSR1: Protein MANNAN SYNTHESIS-RELATED 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006004 fucose metabolic process Biological Process GO:0046354 mannan biosynthetic process Biological Process GO:0052325 cell wall pectin biosynthetic process Biological Process GO:0071555 cell wall organization Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005634 nucleus Cellular Component GO:0005768 endosome Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005797 Golgi medial cisterna Cellular Component GO:0005802 trans-Golgi network Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G38065 ath:AT1G38131 ath:AT1G51630 ath:AT3G21190 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.