TkA01G440000 | RubberDandelionOmics

Gene overview

TkA01G440000

Reference: TK1151 Chr: Chr01 Coordinates: 109936447-109939279 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1397 bp · TkA01G440000|TK1151|cDNA

CAAAAAACCAGCTCCCACTGCACTTGCGTGATTTCCGACTCTTCTTCCACACCTCCGACGACCTACCCTAAACTTTGAAATCAATCGGTCGACGCCTTCGACTCCGGCGGAGATTCTACTTCACCTCCGATGATTTCCGGTCACCGACTGTAAGCTTTGATTCCGGCGACACATGTATCTATATCATCTTCATTTTCCACCTTATTCTCGTTATGCTATCATCTTCAATTTCGCATAGTTGTTCCCATATTATTCTCAGT...

CDS

Download CDS FASTA

720 bp · TkA01G440000|TK1151|CDS

ATGGAGCCTCGTGTGGGGAATAAATATCGATTAGGGCGCAAGATCGGTAGCGGCTCATTCGGAGAGATCTACCTTGGTACCAATATTCATACGAATGAAGAAATTGCTATCAAGCTTGAAAATATCAAAACAAAGCATCCTCAGTTGCTATACGAATCAAAGCTGTACAAGATCCTGCAAGGAGGAACTGGAATCCCAAATGTGAGATGGTTTGGCATTGAAGGAGACTACAATGTTCTTGTGTTGGATTTATTGGGACC...

Protein

Download Protein FASTA

239 aa · TkA01G440000|TK1151|PROTEIN

MEPRVGNKYRLGRKIGSGSFGEIYLGTNIHTNEEIAIKLENIKTKHPQLLYESKLYKILQGGTGIPNVRWFGIEGDYNVLVLDLLGPSLEDWFNFCSRKMSLKTVLMLADQMINRVEYIHCKSFLHRDIKPDNFLMGLGRRANQVYAIDFGLAKKYRDSSTHRHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESLGYVLMYFLRGREMYAPQEPQMERHHHPLARPSGGVIGPTD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G440000`
TK1151 ID	TkA01G440000
OH-1004 ID	LXL04_002572
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G440000

Location Chr01:109936447-109939279 (-)

Description Similar to CKL1: Casein kinase 1-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26100`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At5g57015`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At1g72710`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At2g19470`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release
`At1g03930`	Casein kinases are operationally defined by their preferential utilization of acidic proteins such as caseins as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002572 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004712 protein serine/threonine/tyrosine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G03930

ath:AT1G72710

ath:AT2G19470

ath:AT4G26100

ath:AT5G57015

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.507

Rank 1 · TkA01G440000 · TK1151

Nucleus0.405

Rank 2 · TkA01G440000 · TK1151

Mitochondrion0.194

Rank 3 · TkA01G440000 · TK1151

Cell membrane0.067

Rank 4 · TkA01G440000 · TK1151

Endoplasmic reticulum0.044

Rank 5 · TkA01G440000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase9-219 aa

PF07714PK_Tyr_Ser-Thr11-162 aa

PF03109ABC115-40 aa

PF03109ABC178-159 aa

PF05445Pox_ser-thr_kin97-136 aa

PF17667Pkinase_fungal120-206 aa

PF01636APH123-153 aa

PF01636APH195-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G440000	`PF00069`	Pkinase	9	219	3.7e-25	89.6
TkA01G440000	`PF07714`	PK_Tyr_Ser-Thr	11	162	6.1e-13	49.4
TkA01G440000	`PF03109`	ABC1	15	40	0.00072	19.5
TkA01G440000	`PF03109`	ABC1	78	159	0.00072	19.5
TkA01G440000	`PF05445`	Pox_ser-thr_kin	97	136	0.0093	15.7
TkA01G440000	`PF17667`	Pkinase_fungal	120	206	6.9e-08	32.3
TkA01G440000	`PF01636`	APH	123	153	0.027	15.0
TkA01G440000	`PF01636`	APH	195	216	0.027	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42158`	Arabidopsis thaliana	sp\|P42158\|CKL1_ARATH Casein kinase 1-like protein 1	90.400%	Swiss-Prot	High
`Q8VYK9`	Arabidopsis thaliana	sp\|Q8VYK9\|CKL12_ARATH Casein kinase 1-like protein 12	88.500%	Swiss-Prot	High
`Q9CAI5`	Arabidopsis thaliana	sp\|Q9CAI5\|CKL2_ARATH Casein kinase 1-like protein 2	89.000%	Swiss-Prot	High
`Q9ZUP4`	Arabidopsis thaliana	sp\|Q9ZUP4\|CKL5_ARATH Casein kinase 1-like protein 5	82.300%	Swiss-Prot	High
`Q9ZWB3`	Arabidopsis thaliana	sp\|Q9ZWB3\|CKL9_ARATH Casein kinase 1-like protein 9	78.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card