TkA01G438130 | RubberDandelionOmics

Gene overview

TkA01G438130

Reference: TK1151 Chr: Chr01 Coordinates: 109496230-109497708 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

804 bp · TkA01G438130|TK1151|cDNA

AATAACTGTTATCGATTATCAATACAAAATATAATTCTCTTCTGGTTAGACAATTGGGACGGAGAAAGGCTGATCATCAATGAACGTGTAAACTCCAACAATATTTCGTGGGCTTGGAAGAGAAGACCTAGGAATCCCAATGAATTGTCGGAACAAAACGGCCTCACCGATAGTCTAACGCATCTCCAGATTTCTGATGGGTCGGATGCTTGGTCCTCTAATCTCTCATTCGATGGTTCTTTTTATGTTCGGGATCTTCG...

CDS

Download CDS FASTA

804 bp · TkA01G438130|TK1151|CDS

AATAACTGTTATCGATTATCAATACAAAATATAATTCTCTTCTGGTTAGACAATTGGGACGGAGAAAGGCTGATCATCAATGAACGTGTAAACTCCAACAATATTTCGTGGGCTTGGAAGAGAAGACCTAGGAATCCCAATGAATTGTCGGAACAAAACGGCCTCACCGATAGTCTAACGCATCTCCAGATTTCTGATGGGTCGGATGCTTGGTCCTCTAATCTCTCATTCGATGGTTCTTTTTATGTTCGGGATCTTCG...

Protein

Download Protein FASTA

267 aa · TkA01G438130|TK1151|PROTEIN

NNCYRLSIQNIILFWLDNWDGERLIINERVNSNNISWAWKRRPRNPNELSEQNGLTDSLTHLQISDGSDAWSSNLSFDGSFYVRDLRGLICWFTRFPVINPTVWLHLVPLKVICFVWRACMGRIPTADALLHRNIVLPSSACHLCLNGLDEVNHIFIGCPFAVEVLDWLFNWCGIPSQHFTGVTELVEFVAKWGRCPKKRKLVLAIFYGFIWYMWKARNEKGFNKTSTTVGKMVDNIFTLVFSWIKNRGKYQNCNFAVWS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G438130`
TK1151 ID	TkA01G438130
OH-1004 ID	LXL04_006430
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	51.800
Protein coverage (%)	TK1151 98.876 / OH-1004 38.974 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G438130`
Location	Chr01:109496230-109497708 (+)
Description	Similar to At1g65750: Putative ribonuclease H protein At1g65750
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_006430` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0003676 nucleic acid binding Molecular Function GO:0004523 RNA-DNA hybrid ribonuclease activity Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · TkA01G438130 · TK1151

Nucleus0.310

Rank 2 · TkA01G438130 · TK1151

Cell membrane0.111

Rank 3 · TkA01G438130 · TK1151

Golgi apparatus0.085

Rank 4 · TkA01G438130 · TK1151

Lysosome / Vacuole0.071

Rank 5 · TkA01G438130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13966zf-RVT101-165 aa

PF06750A24_N_bact118-154 aa

PF13966zf-RVT210-218 aa

PF06750A24_N_bact241-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G438130	`PF13966`	zf-RVT	101	165	1.4e-13	52.0
TkA01G438130	`PF06750`	A24_N_bact	118	154	0.037	14.8
TkA01G438130	`PF13966`	zf-RVT	210	218	1.4e-13	52.0
TkA01G438130	`PF06750`	A24_N_bact	241	256	0.037	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card