TkA01G436870 | RubberDandelionOmics

Gene overview

TkA01G436870

Reference: TK1151 Chr: Chr01 Coordinates: 109169415-109172276 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2526 bp · TkA01G436870|TK1151|cDNA

CTTTTCTATGACTATTGTATAACTTCTTAATCATAAGATACTATACTGAAAATCAGTTCTTATTCTATATAGATATCTTATATAATTATTAAGACAACTTTCTCAAATTAGTTGATAGTATTTAATAATAATTTCATATAATGCTGAGCATTGTTTTCTAAAAGTCCAATCAATAAAAAGCACTTTTGCTTTTATAATTTCTTCTCTTTTGTTTGGAAATTGCTAAAAGAGAGCAAAAACCATACACAGAACCGTAAACC...

CDS

Download CDS FASTA

1512 bp · TkA01G436870|TK1151|CDS

ATGCTCAAGCAAATCCTGGCAAAAATCCCTCGGAAATCAACGAAATCAAATCCAACATATTCAGAAGGAAACAATTCTACTCCCGATGTGAACAACAATGGCAGCTTCACCAACACCTGTAACGTTATTTCAAGCCGATTAAACGTCGTGAAGAAAATGTCATCCTCCATTTTCCCAACATCCGGTAACGACATGATCCAACCTCATCTACCTTTCAAAGACGTCCAAAACTCCGACAAAATCAAACTTCTTATCAGCAA...

Protein

Download Protein FASTA

503 aa · TkA01G436870|TK1151|PROTEIN

MLKQILAKIPRKSTKSNPTYSEGNNSTPDVNNNGSFTNTCNVISSRLNVVKKMSSSIFPTSGNDMIQPHLPFKDVQNSDKIKLLISKLNLCSNIYDFNDQDKDSIAKDQKRQVLIEILDFLVSESIKLTEPAMSAICKMCGANIFREFPPKPNGCSPRGESEDDDPWFDPAWTHLQLVYEILLRFISFSSLDPKIAKNYIDHSFLLKLLNLFDSEDPRELECLKSVLHRIYGKFMVHRPFIRTGVSNIIYKFIFETEKHN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G436870`
TK1151 ID	TkA01G436870
OH-1004 ID	LXL04_002600
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 98.242 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G436870

Location Chr01:109169415-109172276 (-)

Description Similar to B'KAPPA: Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25510`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment.	No verified direct reference in this release
`At1g13460`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	No verified direct reference in this release
`At3g26020`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	No verified direct reference in this release
`At4g15415`	The B regulatory subunit may modulate substrate selectivity and catalytic activity, and may also direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).	Regulatory subunit B'gamma of protein phosphatase 2A prevents unnecessary defense reactions under low light in Arabidopsis.2011 · DOI: 10.1104/pp.111.178442

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0555100`	B regulatory subunit of phosphatase 2A (PP2A) involved in salt stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002600 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006555 methionine metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009759 indole glucosinolate biosynthetic process Biological Process

GO:0009908 flower development Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010150 leaf senescence Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0032000 positive regulation of fatty acid beta-oxidation Biological Process

GO:0033353 S-adenosylmethionine cycle Biological Process

KEGG gene cross-reference

ath:AT1G13460

ath:AT3G26020

ath:AT4G15415

ath:AT5G25510

dosa:Os05g0555100

osa:4339558

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.592

Rank 1 · TkA01G436870 · TK1151

Nucleus0.358

Rank 2 · TkA01G436870 · TK1151

Cell membrane0.083

Rank 3 · TkA01G436870 · TK1151

Golgi apparatus0.079

Rank 4 · TkA01G436870 · TK1151

Lysosome / Vacuole0.068

Rank 5 · TkA01G436870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01603B5671-477 aa

PF12783Sec7-like_HUS220-311 aa

PF12783Sec7-like_HUS347-438 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G436870	`PF01603`	B56	71	477	1.2e-169	565.4
TkA01G436870	`PF12783`	Sec7-like_HUS	220	311	2.4	8.7
TkA01G436870	`PF12783`	Sec7-like_HUS	347	438	2.4	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93YV6`	Arabidopsis thaliana	sp\|Q93YV6\|2A5K_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	55.900%	Swiss-Prot	High
`Q8LF36`	Arabidopsis thaliana	sp\|Q8LF36\|2A5T_ARATH Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' theta isoform	56.400%	Swiss-Prot	High
`Q9LU89`	Arabidopsis thaliana	sp\|Q9LU89\|2A5N_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' eta isoform	56.900%	Swiss-Prot	High
`Q8RW96`	Arabidopsis thaliana	sp\|Q8RW96\|2A5G_ARATH Serine/threonine protein phosphatase 2A 59 kDa regulatory subunit B' gamma isoform	57.800%	Swiss-Prot	High
`Q6I621`	Oryza sativa subsp. japonica	sp\|Q6I621\|2A5K_ORYSJ Serine/threonine protein phosphatase 2A 57 kDa regulatory subunit B' kappa isoform	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card