TkA01G436420 | RubberDandelionOmics

Gene overview

TkA01G436420

Reference: TK1151 Chr: Chr01 Coordinates: 109036625-109040526 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1789 bp · TkA01G436420|TK1151|cDNA

AAAACTTATTTGGCGTTTGGATTGGTTCGGAATCTGATGTGTGGTTCCTTTGGTTTCCACGATCCTCTCCTATATCTTCTCTGCAAGTACTGGACCCATCTCACTCTCTTCACTTGCCGAATTCAAACGAAGGGCATGCTCAAATAAAACTTCTTAGTTCTTACCCTTTCACTCTCACCAAGTTTCTTGATCTTCAATGGCGTCTATTTCGAGAATCGTTGCTAAAGATTGTAAATTTCAATCACGTGATGCTGTTCTTC...

CDS

Download CDS FASTA

1248 bp · TkA01G436420|TK1151|CDS

ATGGCGTCTATTTCGAGAATCGTTGCTAAAGATTGTAAATTTCAATCACGTGATGCTGTTCTTCAAAGACCCCGATACGATTTACCTCCACGAGGGCTCTATAAGAATGTTTCTTTTGGAAGTAGGGTTCGTTCGTCTTGTGATGTTAAAAGCTGTTTGGCTATTCAGAATAAGCGATTCACCCCAGCGGTGATTCAATCCTCAGCTTCCAGGAGCTCGAAGATTGTTTGCCAAGCAGCAACGAATGTACCAGGAGAAGT...

Protein

Download Protein FASTA

415 aa · TkA01G436420|TK1151|PROTEIN

MASISRIVAKDCKFQSRDAVLQRPRYDLPPRGLYKNVSFGSRVRSSCDVKSCLAIQNKRFTPAVIQSSASRSSKIVCQAATNVPGEVPVTPTTSTGMSTYEKIIETLTTLFPLWVILGTLIGIYKPSAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPVLGYLIAKALKLSAPLATGLILVSCCPGGQASNVATYISKGNVALSVLMTTCSTIGAIIMTPLLTKLLAGQLVPVDAAGLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G436420`
TK1151 ID	TkA01G436420
OH-1004 ID	LXL04_002606
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G436420

Location Chr01:109036625-109040526 (+)

Description Similar to BASS2: Sodium/pyruvate cotransporter BASS2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26900`	Sodium-coupled metabolite transporter that plays a crucial role in pyruvate transport across the chloroplast envelope.	A plastidial sodium-dependent pyruvate transporter.2011 · DOI: 10.1038/nature10250
`At1g78560`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0645200`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`Os04g0381100`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release
`Os02g0475400`	May function as sodium-coupled metabolite transporter across the chloroplast envelope.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002606 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006849 plasma membrane pyruvate transport Biological Process

GO:0098717 pantothenate import across plasma membrane Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0015293 symporter activity Molecular Function

GO:0050833 pyruvate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G78560

ath:AT2G26900

dosa:Os01g0645200

dosa:Os02g0475400

dosa:Os04g0381100

osa:4335634

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.983

Rank 1 · TkA01G436420 · TK1151

Mitochondrion0.020

Rank 2 · TkA01G436420 · TK1151

Cell membrane0.014

Rank 3 · TkA01G436420 · TK1151

Peroxisome0.012

Rank 4 · TkA01G436420 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA01G436420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04413Glycos_transf_N86-136 aa

PF01758SBF96-121 aa

PF13593SBF_like115-377 aa

PF01758SBF138-316 aa

PF04413Glycos_transf_N209-286 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G436420	`PF04413`	Glycos_transf_N	86	136	0.0065	16.7
TkA01G436420	`PF01758`	SBF	96	121	1.8e-55	188.3
TkA01G436420	`PF13593`	SBF_like	115	377	2.4e-15	57.4
TkA01G436420	`PF01758`	SBF	138	316	1.8e-55	188.3
TkA01G436420	`PF04413`	Glycos_transf_N	209	286	0.0065	16.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1EBV7`	Arabidopsis thaliana	sp\|Q1EBV7\|BASS2_ARATH Sodium/pyruvate cotransporter BASS2, chloroplastic	74.500%	Swiss-Prot	High
`Q93YR2`	Arabidopsis thaliana	sp\|Q93YR2\|BASS1_ARATH Probable sodium/metabolite cotransporter BASS1, chloroplastic	48.300%	Swiss-Prot	Medium
`Q5VRB2`	Oryza sativa subsp. japonica	sp\|Q5VRB2\|BASS2_ORYSJ Probable sodium/metabolite cotransporter BASS2, chloroplastic	79.400%	Swiss-Prot	High
`Q7XVB3`	Oryza sativa subsp. japonica	sp\|Q7XVB3\|BASS1_ORYSJ Probable sodium/metabolite cotransporter BASS1, chloroplastic	47.200%	Swiss-Prot	Medium
`Q6K739`	Oryza sativa subsp. japonica	sp\|Q6K739\|BASS3_ORYSJ Probable sodium/metabolite cotransporter BASS3, chloroplastic	41.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card