Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3198 bp · TkA01G434840|TK1151|cDNA
ATGGCCGTTAATTCCCCCCTGACCAGGAGTAGTCCGCCACGTCCCCGTGGTTGTCGAAGGCCGGTTCAAAGACCTCATCCGCTTCCTTCCCTCCCGACGGTTTTACGGAACAAAAAAGCTGTCACTCGACAGCATCGACGCCGGTGTTCAGGCCACGCCAAGACGCTGGTTTTGATGACAGTTTTGGGCGGGGCAATGGTGGTGCGGAGTCCTCTGTATCCTTATCGCATGCACCGGGTTTTACTGCTTTGCATGTCCAT...
3198 bp · TkA01G434840|TK1151|CDS
ATGGCCGTTAATTCCCCCCTGACCAGGAGTAGTCCGCCACGTCCCCGTGGTTGTCGAAGGCCGGTTCAAAGACCTCATCCGCTTCCTTCCCTCCCGACGGTTTTACGGAACAAAAAAGCTGTCACTCGACAGCATCGACGCCGGTGTTCAGGCCACGCCAAGACGCTGGTTTTGATGACAGTTTTGGGCGGGGCAATGGTGGTGCGGAGTCCTCTGTATCCTTATCGCATGCACCGGGTTTTACTGCTTTGCATGTCCAT...
Protein
Download Protein FASTA1065 aa · TkA01G434840|TK1151|PROTEIN
MAVNSPLTRSSPPRPRGCRRPVQRPHPLPSLPTVLRNKKAVTRQHRRRCSGHAKTLVLMTVLGGAMVVRSPLYPYRMHRVLLLCMSIQMILKKTRVVIKESFIVLEALWIPNGQVISFVSVYAPQSLECKRHMWESISRVIEASSGVCVVMGDFNEVREPSERLGSQFLPGAARVFNTFIEDAGLEEGFLSAFPYLSAMVLEKKIPDHRPILLSEHRVDYGPSPFRMFHSWLSVEGFDAVVRSVWSSQVQGAANPWVVFK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G434840 |
|---|---|
| TK1151 ID | TkA01G434840 |
| OH-1004 ID | LXL04_025559 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 34.100 |
| Protein coverage (%) | TK1151 88.920 / OH-1004 38.129Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G434840 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:108609999-108614086 (-) | |||||||||
| Description | Similar to LINE-1 reverse transcriptase homolog | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006310 DNA recombination Biological Process GO:0032197 retrotransposition Biological Process GO:0090304 nucleic acid metabolic process Biological Process GO:0003723 RNA binding Molecular Function GO:0003964 RNA-directed DNA polymerase activity Molecular Function GO:0004519 endonuclease activity Molecular Function GO:0009036 type II site-specific deoxyribonuclease activity Molecular Function GO:0016787 hydrolase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||
| KEGG gene cross-reference | No functional description available |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03372Exo_endo_phos63-165 aaPF14529Exo_endo_phos_2116-156 aaPF13966zf-RVT244-273 aaPF00078RVT_1298-350 aaPF00078RVT_1493-611 aaPF13966zf-RVT895-961 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G434840 | PF03372 | Exo_endo_phos | 63 | 165 | 0.012 | 16.2 |
| TkA01G434840 | PF14529 | Exo_endo_phos_2 | 116 | 156 | 0.054 | 14.1 |
| TkA01G434840 | PF13966 | zf-RVT | 244 | 273 | 1.1e-13 | 52.3 |
| TkA01G434840 | PF00078 | RVT_1 | 298 | 350 | 8.8e-12 | 46.0 |
| TkA01G434840 | PF00078 | RVT_1 | 493 | 611 | 8.8e-12 | 46.0 |
| TkA01G434840 | PF13966 | zf-RVT | 895 | 961 | 1.1e-13 | 52.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.