Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1536 bp · TkA01G433770|TK1151|cDNA
GAAACGAGAAGCCAATAGAAATGAGGCAGCATAGCCTTTTCGTGATCAACACTCCTCTTGTACACCGACGTACTGAAATCATATCGCTATTGAACAAAAATCTGCAAGCTCACGAAGTATCCATCGTTTAGACACGAATGGCGACAGTGGATATTGCGATGAAACCCGCGGATTCGGGGGACAAAGACGAGGGTTGTTCATCGAGGCACGCGGCGAAACCAGGCGAAGGCCTGAGACAGTATTACCTGCAGCATATCCAC...
1260 bp · TkA01G433770|TK1151|CDS
ATGGCGACAGTGGATATTGCGATGAAACCCGCGGATTCGGGGGACAAAGACGAGGGTTGTTCATCGAGGCACGCGGCGAAACCAGGCGAAGGCCTGAGACAGTATTACCTGCAGCATATCCACGATGCTCAGCTCCAGGTTCGACAGAAGAGTCACAATCTTAATCGCCTCGAGGCTCAGCGTAACGAGCTAAATTCTCGAGTGAGGATGCTTAAGGAAGAGTTACAGCTGCTTCAAGAGCCTGGATCATATGTTGGTGA...
Protein
Download Protein FASTA419 aa · TkA01G433770|TK1151|PROTEIN
MATVDIAMKPADSGDKDEGCSSRHAAKPGEGLRQYYLQHIHDAQLQVRQKSHNLNRLEAQRNELNSRVRMLKEELQLLQEPGSYVGEVVKVMGKSKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKVDPLVNLMKVEKVPDSTYDMIGGLDQQIKEIKEVIELPIKHPELFESLGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKYIGEGSRMVRELFVMAREHAPSIIFM...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G433770 |
|---|---|
| TK1151 ID | TkA01G433770 |
| OH-1004 ID | LXL04_002641 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G433770 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:108347662-108350497 (-) | |||||||||
| Description | Similar to RPT6A: 26S proteasome regulatory subunit 8 homolog A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0010498 proteasomal protein catabolic process Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0090261 positive regulation of inclusion body assembly Biological Process GO:0000502 proteasome complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005838 proteasome regulatory particle Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G19990 ath:AT5G20000 dme:Dmel_CG1489 msex:115452188 rno:81827 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF28733PII1_coiled_coil36-80 aaPF13086AAA_1144-78 aaPF00005ABC_tran46-79 aaPF09845OapC58-112 aaPF16450Prot_ATP_ID_OB_C85-140 aaPF21236OB_PRS788-140 aaPF13479AAA_2492-124 aaPF06745ATPase163-213 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G433770 | PF28733 | PII1_coiled_coil | 36 | 80 | 0.18 | 10.9 |
| TkA01G433770 | PF13086 | AAA_11 | 44 | 78 | 0.058 | 13.9 |
| TkA01G433770 | PF00005 | ABC_tran | 46 | 79 | 0.019 | 16.3 |
| TkA01G433770 | PF09845 | OapC | 58 | 112 | 0.058 | 14.4 |
| TkA01G433770 | PF16450 | Prot_ATP_ID_OB_C | 85 | 140 | 3.5e-13 | 49.9 |
| TkA01G433770 | PF21236 | OB_PRS7 | 88 | 140 | 9.4e-05 | 22.6 |
| TkA01G433770 | PF13479 | AAA_24 | 92 | 124 | 0.016 | 15.6 |
| TkA01G433770 | PF06745 | ATPase | 163 | 213 | 0.016 | 15.3 |
| TkA01G433770 | PF04851 | ResIII | 169 | 218 | 0.11 | 13.1 |
| TkA01G433770 | PF13191 | AAA_16 | 186 | 219 | 3.7e-06 | 28.3 |
| TkA01G433770 | PF00005 | ABC_tran | 190 | 246 | 0.019 | 16.3 |
| TkA01G433770 | PF20030 | bpMoxR | 190 | 221 | 0.1 | 12.4 |
| TkA01G433770 | PF12775 | AAA_7 | 192 | 220 | 0.041 | 14.1 |
| TkA01G433770 | PF05673 | DUF815 | 193 | 262 | 0.028 | 14.3 |
| TkA01G433770 | PF02367 | TsaE | 193 | 235 | 0.065 | 13.9 |
| TkA01G433770 | PF06414 | Zeta_toxin | 193 | 220 | 0.13 | 12.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.