TkA01G433720 | RubberDandelionOmics

Gene overview

TkA01G433720

Reference: TK1151 Chr: Chr01 Coordinates: 108334679-108337070 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1678 bp · TkA01G433720|TK1151|cDNA

TTGCAATTTAGGGTGAAAGTTAACAACAGTGAAGTTTTCACCAATACCCACTTTATCCGAGTCGACCCGGCTTTCCCTATGAGTGCCGTACGGACCACGTGCCGGGTAGATAATGACCATGTATCCAATATCGGTTAATCTGCTTGACAGGCTCGTCGAACGTTCTTTCACTAATTTGTTTACGCAAATTTCAGGTTAGAAGTCGTTAAATGAACGGAGAATTGGAGTTAGAAGGGAGGGATTTGGAAAACCCTAGCGAT...

CDS

Download CDS FASTA

945 bp · TkA01G433720|TK1151|CDS

ATGAACGGAGAATTGGAGTTAGAAGGGAGGGATTTGGAAAACCCTAGCGATTCCGATCCTCTGCTTCCAAGTCACCAACACGTTGATTCTGATACACCGTCTTCGTCGCCATCGCCGGCCGCGGCGACTTCTATTGAGCGAGTAGATGAAGATGTTGAAGAAGGTTCGATAGCCACCTGTCGTATCTGCCTTGAGTGCGACGGCGAAGAAGATGATGATCTGATATCTCCATGCATGTGCAAAGGCACCCAGCAGTTTGT...

Protein

Download Protein FASTA

314 aa · TkA01G433720|TK1151|PROTEIN

MNGELELEGRDLENPSDSDPLLPSHQHVDSDTPSSSPSPAAATSIERVDEDVEEGSIATCRICLECDGEEDDDLISPCMCKGTQQFVHRSCLDHWRSVKEGFAFSHCTTCKAQFHLLVVELEENSWRKIKFRLFVARDVCLVFLAVQTVIGIMGGLAYIADKDGSFRDSFNDSWDRILSRHPIPFYYCIGVLVFFVLLGFFGIILHCSSLNNDPRMAGCQNCCYGWGILDCFPASMEACFALVIVFVVIFAILGIAYGFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G433720`
TK1151 ID	TkA01G433720
OH-1004 ID	LXL04_002642
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G433720`
Location	Chr01:108334679-108337070 (-)
Description	Similar to Marchf8: E3 ubiquitin-protein ligase MARCHF8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002642` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0002495 antigen processing and presentation of peptide antigen via MHC class II Biological Process GO:0006955 immune response Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0045347 negative regulation of MHC class II biosynthetic process Biological Process GO:0000139 Golgi membrane Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005764 lysosome Cellular Component GO:0005765 lysosomal membrane Cellular Component GO:0005768 endosome Cellular Component GO:0005783 endoplasmic reticulum Cellular Component
KEGG gene cross-reference	hsa:55016 mmu:71779 mmu:72925 xla:495072 xtr:448095 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.296

Rank 1 · TkA01G433720 · TK1151

Lysosome / Vacuole0.270

Rank 2 · TkA01G433720 · TK1151

Golgi apparatus0.251

Rank 3 · TkA01G433720 · TK1151

Cytoplasm0.212

Rank 4 · TkA01G433720 · TK1151

Cell membrane0.185

Rank 5 · TkA01G433720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28098HPE1-like_N_CxxC37-86 aa

PF01493GXGXG49-102 aa

PF12906RINGv60-110 aa

PF28098HPE1-like_N_CxxC105-112 aa

PF01493GXGXG149-172 aa

PF28125At5g19025_N178-207 aa

PF28125At5g19025_N234-256 aa

PF13829DUF4191238-273 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G433720	`PF28098`	HPE1-like_N_CxxC	37	86	2.8	8.8
TkA01G433720	`PF01493`	GXGXG	49	102	0.3	11.1
TkA01G433720	`PF12906`	RINGv	60	110	7.2e-11	42.8
TkA01G433720	`PF28098`	HPE1-like_N_CxxC	105	112	2.8	8.8
TkA01G433720	`PF01493`	GXGXG	149	172	0.3	11.1
TkA01G433720	`PF28125`	At5g19025_N	178	207	0.29	12.7
TkA01G433720	`PF28125`	At5g19025_N	234	256	0.29	12.7
TkA01G433720	`PF13829`	DUF4191	238	273	0.16	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card