TkA01G433030 | RubberDandelionOmics

Gene overview

TkA01G433030

Reference: TK1151 Chr: Chr01 Coordinates: 108161888-108164255 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · TkA01G433030|TK1151|cDNA

AATTGAACGAAACGAAGGGCTGACGTGGCAGTGGGCCTACACCCTTGTGCCCTAATTTGAAGATTCACATATACACCTTCCCTCTTTTAACATATTTGCAATCGCTCTCTTTGTCTCCCTCCATAATTCCTCACCGAAAGCTTATACAAATGGGAAGCGCAGCTAACGGTGCCGCCGTGGATATGGATACATCCACCAGCAATGGCAGCGCCACCGTCGACAAAGGCGTCGATTTCGCTAATTATTTCTGCACATACGCC...

CDS

Download CDS FASTA

576 bp · TkA01G433030|TK1151|CDS

ATGAATGATTATGAAGGATGCATGGATGACTGGAGCGGTTTCATAAACGAAACCAAATCTTATTACGGTGTGGATATGAGTGTTTTGACAAAACCCTTTTCTCAAGAACAAAAGAAGTATTACTTACAGAATTCGATTTGGAACAATCTGCATCCGAATCAGGTAGTGGGAACACCTGCTGTTTTAAAGGAGATTGATTGTTTAAAGGTAACTGTTGAAGACATTCTCAAAGTTGAAGCTGTTGTTTCTTCAACAATTGT...

Protein

Download Protein FASTA

191 aa · TkA01G433030|TK1151|PROTEIN

MNDYEGCMDDWSGFINETKSYYGVDMSVLTKPFSQEQKKYYLQNSIWNNLHPNQVVGTPAVLKEIDCLKVTVEDILKVEAVVSSTIVQEDTRLCGFSGWFDVHFKGREENPAECEVELTTAPSIDDGTHWGQQVFLLQPPVRVNEKDEVHMKFSMSRSEENHRLMKVDLGYQIKLSSGKMLTPVENKFYIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G433030`
TK1151 ID	TkA01G433030
OH-1004 ID	LXL04_018263
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.900
Protein coverage (%)	TK1151 100.000 / OH-1004 46.472 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G433030

Location Chr01:108161888-108164255 (+)

Description Similar to PRMT10: Protein arginine N-methyltransferase PRMT10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04870`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.2011 · DOI: 10.1016/j.jmb.2011.09.040

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0142800`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	No verified direct reference in this release
`UniProt: A2Y953`	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine Biological Process

GO:0032259 methylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0016274 protein-arginine N-methyltransferase activity Molecular Function

GO:0035241 protein-arginine omega-N monomethyltransferase activity Molecular Function

GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity Molecular Function

GO:0042054 histone methyltransferase activity Molecular Function

GO:0044020 histone H4R3 methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G04870

dosa:Os06g0142800

osa:9268644

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.637

Rank 1 · TkA01G433030 · TK1151

Nucleus0.482

Rank 2 · TkA01G433030 · TK1151

Mitochondrion0.065

Rank 3 · TkA01G433030 · TK1151

Endoplasmic reticulum0.040

Rank 4 · TkA01G433030 · TK1151

Cell membrane0.039

Rank 5 · TkA01G433030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22528PRMT_C4-174 aa

PF07203DUF141235-62 aa

PF17286PRMT5_C45-163 aa

PF23350BBS2_pf110-168 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G433030	`PF22528`	PRMT_C	4	174	6e-23	82.3
TkA01G433030	`PF07203`	DUF1412	35	62	0.095	13.4
TkA01G433030	`PF17286`	PRMT5_C	45	163	0.0063	17.2
TkA01G433030	`PF23350`	BBS2_pf	110	168	0.081	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAT5`	Arabidopsis thaliana	sp\|Q9MAT5\|ANM10_ARATH Protein arginine N-methyltransferase PRMT10	53.700%	Swiss-Prot	High
`Q9SNQ2`	Oryza sativa subsp. japonica	sp\|Q9SNQ2\|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10	56.000%	Swiss-Prot	High
`A2Y953`	Oryza sativa subsp. indica	sp\|A2Y953\|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10	56.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card