TkA01G431420 | RubberDandelionOmics

Gene overview

TkA01G431420

Reference: TK1151 Chr: Chr01 Coordinates: 107815532-107818721 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2646 bp · TkA01G431420|TK1151|cDNA

AGTACGGTAGCCCTCTGCCACCCACTCCCCCTCCTCCTTCCCCTTTAAACTTCCATTTTCACCGGAGCTTTCTCTCTCTCTCTCTCCGCCATGAAAACCAACCCATCATCTCCTCATTTTTCTTAAAATAGGGGTTTTTCACTCATGAAAGCTCCCAAAACCCTCTTTACCATTGCCAAGCGACCTTTCTCCTTCTGATCAATCTCTTGATATTCTTCCCCTATATTTCACAACTATATACTTCCCCCACAGCACTCTAG...

CDS

Download CDS FASTA

1914 bp · TkA01G431420|TK1151|CDS

ATGTCGCATTCGTTCTTCTCCGATTCTTACGCAGAGATGGCTTCAAAAACCGCACGTGGTCGACCCAACTACGTTCCTCCACACCAGAGGAACAACTACACTGCAGATGAAGCCGTGAAATATAGTTATCAAACCGGAAATAATGGCAGCTTTCGCGGCCGTGGGCGCGGTGGCGGTGGCGGTGGTAGAGGCGGCGGTCCTGGTTTTATACGCGGCTACTCTGTGGTGGATAAAGAGTTTCATGATCCTAACAGACATGC...

Protein

Download Protein FASTA

637 aa · TkA01G431420|TK1151|PROTEIN

MSHSFFSDSYAEMASKTARGRPNYVPPHQRNNYTADEAVKYSYQTGNNGSFRGRGRGGGGGGRGGGPGFIRGYSVVDKEFHDPNRHARTRNQYDDLTEKFNELEVSEKEHTSMAINFDAYEDIPVEVTGSDVPKPVDTFADIDLGDSLNDNIKNRCKYVKPTPIQRHAIPVALAGRDLMACAQTGSGKTAAFCFPIICGVLKLQSPVPYGRREMMSYPLALILSPTRELCCQIFEEAKKFCHQTGVKVAVAYGGAPIQQQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G431420`
TK1151 ID	TkA01G431420
OH-1004 ID	LXL04_002665
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G431420

Location Chr01:107815532-107818721 (-)

Description Similar to PL10B: DEAD-box ATP-dependent RNA helicase 52B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g58570`	DEAD-box ATP-dependent RNA helicase 52.	No verified direct reference in this release
`At2g42520`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release
`At3g58510`	DEAD-box ATP-dependent RNA helicase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0202100`	DEAD-box ATP-dependent RNA helicase 52B.	No verified direct reference in this release
`Os03g0805200`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002665 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G58510

ath:AT3G58570

dosa:Os03g0805200

dosa:Os07g0202100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.647

Rank 1 · TkA01G431420 · TK1151

Nucleus0.519

Rank 2 · TkA01G431420 · TK1151

Endoplasmic reticulum0.065

Rank 3 · TkA01G431420 · TK1151

Cell membrane0.058

Rank 4 · TkA01G431420 · TK1151

Mitochondrion0.047

Rank 5 · TkA01G431420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09938DUF217082-131 aa

PF13035DUF389694-123 aa

PF00270DEAD162-342 aa

PF04851ResIII177-336 aa

PF00271Helicase_C220-274 aa

PF00271Helicase_C378-493 aa

PF22590Cas3-like_C_2423-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G431420	`PF09938`	DUF2170	82	131	0.24	11.9
TkA01G431420	`PF13035`	DUF3896	94	123	0.28	12.1
TkA01G431420	`PF00270`	DEAD	162	342	3.6e-51	173.9
TkA01G431420	`PF04851`	ResIII	177	336	0.041	14.5
TkA01G431420	`PF00271`	Helicase_C	220	274	9.2e-34	116.7
TkA01G431420	`PF00271`	Helicase_C	378	493	9.2e-34	116.7
TkA01G431420	`PF22590`	Cas3-like_C_2	423	492	0.18	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2F9`	Arabidopsis thaliana	sp\|Q9M2F9\|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52	70.100%	Swiss-Prot	High
`Q84W89`	Arabidopsis thaliana	sp\|Q84W89\|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37	69.200%	Swiss-Prot	High
`Q8LA13`	Arabidopsis thaliana	sp\|Q8LA13\|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11	69.400%	Swiss-Prot	High
`Q6Z4K6`	Oryza sativa subsp. japonica	sp\|Q6Z4K6\|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B	70.100%	Swiss-Prot	Medium
`Q75HJ0`	Oryza sativa subsp. japonica	sp\|Q75HJ0\|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37	70.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card