TkA01G431120 | RubberDandelionOmics

Gene overview

TkA01G431120

Reference: TK1151 Chr: Chr01 Coordinates: 107723524-107725388 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1743 bp · TkA01G431120|TK1151|cDNA

AATATCTCCCTTGATAAATCGATTTCACATAGCCTCGTATATATATTTAACGTTCGGCCGTATTCACCGCTCCTTTGTTCTACTGGGGTTCCCAGTGGATGAAAATTTCTCTCTTTCTCTCTGTTCCAACTTCGATCGTTAATCGCTAAAACCTCCATTCAATTTGTCTTAAATTAAGGATATCTCATCTCGCAGGGTTCCCGATTGCTGTTGTTTATTAGAACTGGGGTCTCCTTGATCGGTTCCTGGTAAAATTCCGA...

CDS

Download CDS FASTA

1083 bp · TkA01G431120|TK1151|CDS

ATGGATGGAAATAAAGACGACGCTTTGAGATGTTTAAAAATCGGAAAAGATGCATTAGGGCTGGGTGATCGAGCTCGTGCCCTCAAATTCATCTCGAAAGCTAGACGATTGGATCCTTCGCTTCCTGTCGACGATCTGTTATCGAATCTAGAACCCGACAATCCGGCCAACGAATCGCCTTCCGGTTCACCTTCGGCGAAACCGTCAGAGAATAGCGCAGATGACAGTTCTGGTGTACGGCGTAGGGCTCCGCCAACCGG...

Protein

Download Protein FASTA

360 aa · TkA01G431120|TK1151|PROTEIN

MDGNKDDALRCLKIGKDALGLGDRARALKFISKARRLDPSLPVDDLLSNLEPDNPANESPSGSPSAKPSENSADDSSGVRRRAPPTGSSSPGAYTEEQITIVSEIKRKKDYYDILGLEKSCTVDDIRKAYRKLSLKVHPDKNKAPGSEEAFKKVSKAFQCLRVDEYRKQYDLLGSDEPLYEMRTQRGGGHRHGFTNGGFYYDGDIDAEEIFRNFFGGMNHGATTQFTGFTFGPGMGTGMPAGNASGGIRTLIQILPVLLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G431120`
TK1151 ID	TkA01G431120
OH-1004 ID	LXL04_002672
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G431120

Location Chr01:107723524-107725388 (-)

Description Similar to ATJ49: Chaperone protein dnaJ 49

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49060`	Plays a continuous role in plant development probably in the structural organization of compartments.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_002672 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0065003 protein-containing complex assembly Biological Process

GO:0071218 cellular response to misfolded protein Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0030544 Hsp70 protein binding Molecular Function

KEGG gene cross-reference

ath:AT5G49060

bta:533603

hsa:54788

mmu:56709

xla:380336

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.553

Rank 1 · TkA01G431120 · TK1151

Cytoplasm0.248

Rank 2 · TkA01G431120 · TK1151

Nucleus0.226

Rank 3 · TkA01G431120 · TK1151

Golgi apparatus0.109

Rank 4 · TkA01G431120 · TK1151

Mitochondrion0.107

Rank 5 · TkA01G431120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07719TPR_23-13 aa

PF07719TPR_212-40 aa

PF00226DnaJ110-171 aa

PF30912TIM141_C110-158 aa

PF09320DUF1977267-336 aa

PF09320DUF1977336-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G431120	`PF07719`	TPR_2	3	13	0.071	14.0
TkA01G431120	`PF07719`	TPR_2	12	40	0.071	14.0
TkA01G431120	`PF00226`	DnaJ	110	171	7.8e-23	81.1
TkA01G431120	`PF30912`	TIM141_C	110	158	0.014	16.1
TkA01G431120	`PF09320`	DUF1977	267	336	1.3e-07	32.5
TkA01G431120	`PF09320`	DUF1977	336	351	1.3e-07	32.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH28`	Arabidopsis thaliana	sp\|Q9FH28\|DNJ49_ARATH Chaperone protein dnaJ 49	45.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card